Align Phosphoglycerate mutase family protein, putative (characterized, see rationale)
to candidate NP_348013.1 CA_C1385 alpha-ribazole-5'-phosphate phosphatase
Query= uniprot:N9V397 (205 letters) >NCBI__GCF_000008765.1:NP_348013.1 Length = 191 Score = 82.0 bits (201), Expect = 6e-21 Identities = 62/201 (30%), Positives = 97/201 (48%), Gaps = 21/201 (10%) Query: 1 MTKLILIRHGETEWNLLGKIQGCTDIELTPNGIQQANEVAQQIKG-NFDIIYSSPLHRAL 59 M ++ L+RHGET+ N K G TD+EL GI +A V +++ FD + SSPL RA Sbjct: 1 MLRITLVRHGETDSNRNKKYLGWTDVELNEKGIAEAEMVRDKLRDTKFDFVISSPLKRAK 60 Query: 60 ITAQKIAGDKEVHLIEGMKEIPFGTWEGHTFEELNG---------DINYKKFLSGEDGCP 110 TA KI D + + +KEI FG W+ +++E+ ++K F+ + P Sbjct: 61 ATA-KIIRDTNIIYEDALKEINFGLWDNLSYKEIKDKYPDECEKWSSDWKSFVFPQGEGP 119 Query: 111 FDSTGMSIASWSKKNAQLLLDLCKQNENKTIVCVSHGAWIKTSILGLLEMEPTMYHKFQL 170 + ++++ K + +I+ V+HG I+++I LLEM F Sbjct: 120 KEMY-TRVSNFMNK---------LKGMEGSILIVTHGGIIRSTIAYLLEMGIEGAWHFAT 169 Query: 171 GNTGITTFIFRHGHPVLTSFN 191 N GIT R + VL S N Sbjct: 170 NNCGITVIEVRDSYAVLKSLN 190 Lambda K H 0.318 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 191 Length adjustment: 20 Effective length of query: 185 Effective length of database: 171 Effective search space: 31635 Effective search space used: 31635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory