Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_011652371.1 RL_RS14705 shikimate dehydrogenase
Query= BRENDA::Q6PUG0 (521 letters) >NCBI__GCF_000009265.1:WP_011652371.1 Length = 280 Score = 115 bits (288), Expect = 2e-30 Identities = 86/272 (31%), Positives = 134/272 (49%), Gaps = 30/272 (11%) Query: 245 LISKPVGHSKGPILHNPTFRHVGYNGIYVPMFV--DDLKEFFRVYSSPDFAGFSVGIPYK 302 ++ P+ HS+ P+LH + G G Y + V D+ FF + + G ++ +P+K Sbjct: 8 VMGHPIAHSRSPMLHGYWLKRCGIEGSYERLDVPPQDIDSFFSGFREAGWIGGNITVPHK 67 Query: 303 EAVVSFCDEVDPLAKSIGAVNTIIQRPCDGKLIGYNTDCEASITAIEDALKVNGLTNGAA 362 AV+ D +D A+ +GAVNTI DG L+G NTD + I++ Sbjct: 68 TAVIPHLDHIDDAARKMGAVNTIWWE--DGVLVGGNTDAIGFLGNIDE------------ 113 Query: 363 FLPSPLAGKLFVLVGAGGAGRALAFGAKSRRAEIVIFDIDFDRAKALA----AAVSGE-- 416 P GK V++GAGGA RA +G SR + + + +A+ALA A VS Sbjct: 114 LAPGWDKGKRAVILGAGGATRAATYGLLSRGLTVALCNRTVSKAEALASHFGAGVSAHGM 173 Query: 417 -ALPFENLASFQPEKGAILANATPIGMHPNKDRIPVSEASLKDYVVVFDAVYTPRKTTLL 475 ALP E +A +L N T +GM + + + + LK +V+D +Y P +T L+ Sbjct: 174 NALP-ELIAECD-----LLVNTTSLGMI-GQPPLDIDLSPLKKDAIVYDVIYVPLETELI 226 Query: 476 KDAEAAGAITVSGVEMFLRQAIGQFHLFTRTK 507 K A+A G +V G+ M L Q + F+ + R K Sbjct: 227 KAAKARGHRSVDGLGMLLHQGVVGFNRWFRIK 258 Lambda K H 0.320 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 280 Length adjustment: 30 Effective length of query: 491 Effective length of database: 250 Effective search space: 122750 Effective search space used: 122750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory