Align Branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011652702.1 RL_RS16490 PLP-dependent aminotransferase family protein
Query= reanno::azobra:AZOBR_RS06555 (404 letters) >NCBI__GCF_000009265.1:WP_011652702.1 Length = 406 Score = 404 bits (1037), Expect = e-117 Identities = 206/400 (51%), Positives = 267/400 (66%), Gaps = 4/400 (1%) Query: 3 VDWGNVFAGRVAGMGASEIRELLKLLERPEIISFAGGIPDPDFFPTAAIARAYEKIFQSN 62 ++W +FA R + M ASEIRELLKLL+RP+IISFAGGIPDP FP +AY IF Sbjct: 2 LNWDTMFASRSSRMRASEIRELLKLLDRPDIISFAGGIPDPALFPDQEFKQAYADIFDG- 60 Query: 63 SGAGGALQYTISEGFTPLREWICAYLGRRGIQAGLDEVLVTSGSQQALEFVGKLLIGPGE 122 + ALQY++SEG+ PLREW+ + I+ LD V + SGSQQ L+++GKL + P + Sbjct: 61 AAVNSALQYSVSEGYKPLREWLVGQMAALDIRCELDNVFIVSGSQQGLDYLGKLFLSPDD 120 Query: 123 KILVTRPTYLGALQAFSPYEPQY--LSVPGDAEGPDLAAVEAALEQKPKFFYLVPDFQNP 180 LVT PTYLGALQAF+ YEP Y L+ G+ A +A K KF YL DF NP Sbjct: 121 TALVTWPTYLGALQAFNAYEPAYDQLTPNGNRTPESYRAAASAAGGKVKFAYLSTDFSNP 180 Query: 181 NGTTISLARREALLDLCAKHGVPIVEDAAYTELRYEGEPIPSMVALDAARNGG-KITNVL 239 G T+ L R+ +L L + ++EDAAY LRY+G+PIP ++AL+ A G T + Sbjct: 181 TGETVDLDGRKKVLALAEDLDIAVIEDAAYQSLRYDGDPIPPILALEIAEKGHINDTRTI 240 Query: 240 FCGSFSKTMVPALRVGWINGPAEVINRLVLMKQAGDLHTSTINQIVLHDVVSQNFDSHIR 299 +CGSFSKT+ P LRVG+I A VI +LVLMKQA DLH+STINQ+ + DV + FD+ + Sbjct: 241 YCGSFSKTLAPGLRVGFIVANAPVIRKLVLMKQAADLHSSTINQMAISDVAERGFDAQVA 300 Query: 300 RLRAGYKERRDAMLTALSEFAPAGVTWTKPEGGMFVWIELPEGTDGVDLLARAIKDANVA 359 +++A Y RRD ML AL ++ P G +WTKPEGGMF+WI LPEG DG LLA++++ A VA Sbjct: 301 KIKAAYSRRRDCMLAALEKYMPEGTSWTKPEGGMFIWITLPEGMDGAKLLAKSLETAKVA 360 Query: 360 FVPGSAFHADRSGKNTLRLSFSNNNPERIREGIRRLCGLL 399 FVPG AF AD SG NT R+SFS N + I +GI RL L+ Sbjct: 361 FVPGKAFFADGSGANTFRVSFSCANEQMIEDGIGRLSALI 400 Lambda K H 0.320 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 406 Length adjustment: 31 Effective length of query: 373 Effective length of database: 375 Effective search space: 139875 Effective search space used: 139875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory