Align Acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate WP_011649047.1 RL_RS34280 acetolactate synthase large subunit
Query= curated2:Q7U5G1 (617 letters) >NCBI__GCF_000009265.1:WP_011649047.1 Length = 548 Score = 238 bits (606), Expect = 7e-67 Identities = 170/547 (31%), Positives = 267/547 (48%), Gaps = 24/547 (4%) Query: 23 GAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEGWVKHILVRHEQAGTHAADAYA 82 G+ L+ A+ GVD IFG PG L + +++ + ++ +L RHEQA A Y Sbjct: 4 GSDLLVAAIENEGVDRIFGIPGEENLDVVESIRKSS----IELVLTRHEQAAAFMAATYG 59 Query: 83 RATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDAFQETDIFGIT 142 R TGK GVC T GPGA NL TG A A + ++PMV+ITGQ + FQ D+ Sbjct: 60 RLTGKPGVCLTTLGPGALNLSTGAAYALLGAMPMVMITGQKGILSSRQARFQVVDVVASM 119 Query: 143 LPIVKHSWVVRDPADLGSIVAQAFLIAASGRPGPVLIDIPKDVGQEQFNYVPVEPGSVIP 202 P+ K + + P + + V +AF IA +PGPV +++P+D+ E+ V + + P Sbjct: 120 KPLTKLARQIVSPQMIPTTVREAFRIAQEEKPGPVHLELPEDIAAEECQEVAL----IAP 175 Query: 203 GGFHQPEPPL--DAAVAAALDLIEQAQRPLLYVGGGAISACAHDSLRMLAERYQLPVTTT 260 HQ E P DAA+ A DLI A+RPLL G A + + R ++P TT Sbjct: 176 ---HQLELPTASDAALDRAADLIAAAKRPLLMFGAAASRPRSTSDIAQFVIRTRIPFFTT 232 Query: 261 LMGKGAFDENDALSVGMLGMHGTAYANFAVTECDLLIAVGARFDDRVTGKLDTFAPRARV 320 MGKG L +G + Y + A+ + DL+I +G ++ + P +V Sbjct: 233 QMGKGTVPGGTELYMGTAALSERDYVHEAIEQADLIITIGHDTIEKPPFIMGKGGP--KV 290 Query: 321 VHFEIDPAEIGKNRKADVAVLGDLGLSLARMVEISLQRTAEPRTAAWLERINTWKDRYPL 380 VH PA + + V+GD+G SL + + + P A L +R + Sbjct: 291 VHVGYQPATVEQVYFPQSEVIGDIGPSLKALADRLEGKL--PNAHALLHLRERILER--I 346 Query: 381 TIPPAEGAIYPQEVLLAVRDLAP-DAIVTTDVGQHQMWAAQHLRNG-PRGWISSAGLGTM 438 E PQ ++ +R++ P D I+ D G +++W A++ R + L TM Sbjct: 347 AARATEDRFTPQRLVHDIREVMPHDGILALDNGMYKIWFARNYRTRMANTLLLDNALATM 406 Query: 439 GFGMPAAMGAQVAMPDRQVVCIAGDASILMNIQELGTLAAYGLPVKVVIVNNHWQGMVRQ 498 G G+P+AM A + P+R+V+ I GD +MN QEL T L + V+++ ++ GM+R Sbjct: 407 GAGLPSAMVASMLYPERRVMAICGDGGFMMNSQELETAVRLKLNLVVLVIEDNAYGMIR- 465 Query: 499 WQESFYDERYSASDMLNGMPDFIALARSFGVDGVKITDRELLHRDLAAALQSPTPTMIDV 558 W+++ + + M G PDF+ A S+G G ++ D + L A +++V Sbjct: 466 WKQAV--DEFPDFGMTFGNPDFVKYAESYGARGTRVEDISQFKQVLEEAFSGGGVHLVNV 523 Query: 559 HVRRGEN 565 V EN Sbjct: 524 PVDYSEN 530 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 766 Number of extensions: 38 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 617 Length of database: 548 Length adjustment: 36 Effective length of query: 581 Effective length of database: 512 Effective search space: 297472 Effective search space used: 297472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory