Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_043879897.1 AZC_RS01200 D-glycerate dehydrogenase
Query= BRENDA::O58256 (333 letters) >NCBI__GCF_000010525.1:WP_043879897.1 Length = 333 Score = 163 bits (413), Expect = 5e-45 Identities = 101/291 (34%), Positives = 168/291 (57%), Gaps = 11/291 (3%) Query: 40 IGRFDGIIVSPTTKITREVLENA-ERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLS 98 + R D ++ + T +I VL A E L++I+ S G D+ID+ A RGI VT G+L+ Sbjct: 46 VKRADVLVPTLTDRIDTAVLSQAGENLRLIASFSNGVDHIDVATALARGITVTNTPGVLT 105 Query: 99 EAVAEFTVGLIINLMRKIHYADKFIR--RGEWESHAKIWTGFKRIESLYGKKVGILGMGA 156 E A+FT+ LI+ L R++ + + + +W + W +RI +GK++GI+GMG Sbjct: 106 EDTADFTMALILALPRRVTEGAQVLTGDQDDWAGWSPTWMLGRRI---WGKRLGIIGMGR 162 Query: 157 IGKAIARRLIPFGVKLYYWSRHRKVN-VEKELKARYMD-IDELLEKSDIVILALPLTRDT 214 IG+A+ARR FG++++Y +R R +E L+A Y D +D++L + DIV + P T T Sbjct: 163 IGQAVARRAKAFGLQIHYHNRRRLPGAIEDALEATYWDSLDQMLARMDIVSVNCPHTPAT 222 Query: 215 YHIINEERVKKLEGK-YLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVREHELF 273 +H+++ R+K L+ + Y+VN RG ++DE A+ ++ +L G DVFE+EP +L Sbjct: 223 FHLLSARRLKLLKREAYVVNTARGEIIDENALARMLEADELGGAGLDVFEQEPAVNPKLV 282 Query: 274 KY--EWETVLTPHYAGLALEAQEDVGFRAVENLLKVLRGEVPEDLVNKEVL 322 + + + VL PH LE + D+G + + N+ + G P D V +L Sbjct: 283 RLARQGKVVLMPHMGSATLEGRIDMGEKVIVNIRTFMDGHRPPDRVLPSML 333 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 333 Length adjustment: 28 Effective length of query: 305 Effective length of database: 305 Effective search space: 93025 Effective search space used: 93025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory