Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_012974787.1 AZL_RS11825 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000010725.1:WP_012974787.1 Length = 359 Score = 435 bits (1118), Expect = e-126 Identities = 220/361 (60%), Positives = 275/361 (76%), Gaps = 10/361 (2%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLT-EADLQHDLDRRRPGTSRYTTQR 59 MAGN+ G LFR TT+GESHG A+G +VDG P + L E D+Q +D+RRPG SRYTTQR Sbjct: 1 MAGNSFGTLFRFTTWGESHGPAIGVVVDGCPSLLDLVAETDIQPWMDKRRPGQSRYTTQR 60 Query: 60 REPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRD 119 +EPDQV+ILSGVFEG TTGT I LLIENTDQRS+DYS I FRPGHADYTY QKYG+RD Sbjct: 61 QEPDQVRILSGVFEGKTTGTPISLLIENTDQRSKDYSDIAGKFRPGHADYTYWQKYGIRD 120 Query: 120 YRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNP 177 YRGGGRSSARETA RVAAGA+A+K L I++RG L Q+G +D DW++++ NP Sbjct: 121 YRGGGRSSARETACRVAAGAVARKVLGS--AIQVRGALVQVGPHRIDHSRWDWAEIDNNP 178 Query: 178 FFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSI 237 FFCPDP + + ++K G S GA V +VASGVP GLG+P++D+LD+D+A A+M+I Sbjct: 179 FFCPDPVAAAQWADYLDGIRKSGSSAGAVVELVASGVPVGLGDPLYDKLDSDLARAMMTI 238 Query: 238 NAVKGVEIGDGFDVVALRGSQNRDEIT--KDG---FQSNHAGGILGGISSGQQIIAHMAL 292 NAVKGVEIG+GF AL G +N D++ +DG F SNHAGGILGGIS+GQ I+ A+ Sbjct: 239 NAVKGVEIGNGFAAAALTGEENADQMRMGQDGRPQFLSNHAGGILGGISTGQDIVVRFAV 298 Query: 293 KPTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNA 352 KPTSSI P +T++ G + +++TKGRHDPCVGIRAVP+ EAM+A VL DHLLR+RA+ Sbjct: 299 KPTSSILTPRQTVDTAGNDTDILTKGRHDPCVGIRAVPVGEAMMACVLADHLLRRRAERR 358 Query: 353 D 353 + Sbjct: 359 E 359 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 359 Length adjustment: 29 Effective length of query: 332 Effective length of database: 330 Effective search space: 109560 Effective search space used: 109560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012974787.1 AZL_RS11825 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.26724.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-139 450.5 0.0 2.1e-139 450.3 0.0 1.0 1 lcl|NCBI__GCF_000010725.1:WP_012974787.1 AZL_RS11825 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000010725.1:WP_012974787.1 AZL_RS11825 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.3 0.0 2.1e-139 2.1e-139 1 350 [. 10 356 .. 10 357 .. 0.98 Alignments for each domain: == domain 1 score: 450.3 bits; conditional E-value: 2.1e-139 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglel.teediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTt 68 +r+tt+GeSHg+a+g+++dG+P+ l l e diq+ +++Rrpgqsr+t++r+E D+v+ilsGvfeGkTt lcl|NCBI__GCF_000010725.1:WP_012974787.1 10 FRFTTWGESHGPAIGVVVDGCPSLLDLvAETDIQPWMDKRRPGQSRYTTQRQEPDQVRILSGVFEGKTT 78 89***********************9725679************************************* PP TIGR00033 69 GaPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLk 137 G+Pi+lli+N+d+rskdy+di+ ++RPgHadyty++KYgi+d++gggrsSaReTa+rvaaGava+k L lcl|NCBI__GCF_000010725.1:WP_012974787.1 79 GTPISLLIENTDQRSKDYSDIAGKFRPGHADYTYWQKYGIRDYRGGGRSSARETACRVAAGAVARKVLG 147 ********************************************************************9 PP TIGR00033 138 etagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevv 206 + i++ + +v++g +++++ + ++d++p++cpd+ a+++ +++d ++k+g s G+vve+v lcl|NCBI__GCF_000010725.1:WP_012974787.1 148 S--AIQVRGALVQVGPHRIDHSRWD---WAEIDNNPFFCPDPVAAAQWADYLDGIRKSGSSAGAVVELV 211 9..69***************98888...479************************************** PP TIGR00033 207 vsnvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrktnnsG 274 +s+vpvglG+pl+dkld+ la+a+++inAvKgveiG+GF+aa +G e D++ + d++ ++ +n+ G lcl|NCBI__GCF_000010725.1:WP_012974787.1 212 ASGVPVGLGDPLYDKLDSDLARAMMTINAVKGVEIGNGFAAAALTGEENADQMRMGqDGRPQFLSNHAG 280 ******************************************************9989999******** PP TIGR00033 275 GieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvlada 343 Gi+GGi++G+di+vr avKp+++i +p++tvd++++++ tkgRhDpcv +ravpv Eam+a vlad+ lcl|NCBI__GCF_000010725.1:WP_012974787.1 281 GILGGISTGQDIVVRFAVKPTSSILTPRQTVDTAGNDTDILTKGRHDPCVGIRAVPVGEAMMACVLADH 349 ********************************************************************* PP TIGR00033 344 llekras 350 ll++ra+ lcl|NCBI__GCF_000010725.1:WP_012974787.1 350 LLRRRAE 356 **99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.96 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory