Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_012973672.1 AZL_RS05545 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000010725.1:WP_012973672.1 Length = 414 Score = 406 bits (1044), Expect = e-118 Identities = 202/408 (49%), Positives = 283/408 (69%), Gaps = 2/408 (0%) Query: 225 KFSYPKSRINVLLLENVHPIGVEIMKQEGY-NVEVVSSAMSEEELCEKIKNVSIIGIRSK 283 K S K +IN+LLLE VH ++ + + GY +VE + A+ E EL E+I +V I+GIRS+ Sbjct: 3 KLSLSKDKINILLLEGVHDNAIDELARGGYASVERLPRALDESELLERIGSVHILGIRSR 62 Query: 284 TQITKKVLENANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIF 343 T +T KV E A +L+ VG FCIGTNQ+DL+ + GI VFNAP+SNTRSV EL I EII Sbjct: 63 THLTAKVFEAAQKLITVGCFCIGTNQVDLKAARRNGIPVFNAPYSNTRSVAELVIGEIIM 122 Query: 344 LMRNLHDKTLKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYDI 403 LMR + +K+ +H G W KSA S+E+RGK LGI+GYG+IG Q+S+LAE MGM V +YD Sbjct: 123 LMRGIFEKSQLVHGGGWMKSAKDSYEIRGKTLGIVGYGHIGTQVSILAEAMGMQVRFYDT 182 Query: 404 VERLALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGH 463 V +LALGNA DSL+ELL D+++LHV + +N++ + ++ MK G+ L+N +RG Sbjct: 183 VRKLALGNARACDSLEELLSVSDVVTLHVPDTPQTRNMIGERELAAMKNGSHLINAARGQ 242 Query: 464 VVDVPALRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQE 523 VV + AL A++SGH+ GAA+DVFP EP ++ E F+S L G ILTPHIGGST+EAQ Sbjct: 243 VVVIEALAAAMKSGHVLGAAIDVFPVEPGSDKEEFQSALRGIKTAILTPHIGGSTMEAQA 302 Query: 524 NIAQFVPGKIIEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASY 583 NI V K+IEY ++G+T +VNFP + LP R +H+H+N PG+L K+N+V + Sbjct: 303 NIGTEVAQKLIEYSDNGSTVGAVNFPQVALPVQAGCTRFLHVHENRPGMLRKVNEVFSGR 362 Query: 584 KINIVGQYLKTNEKIGYVITDIDKRYSN-DVIDALKEIEGTIRFRILY 630 +NI QYL+T+ ++GYV+ D+D +V + L+ IEGT++ R L+ Sbjct: 363 DLNIAAQYLQTDPELGYVVVDVDGDVEELEVTNDLRAIEGTLKARFLF 410 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 414 Length adjustment: 34 Effective length of query: 596 Effective length of database: 380 Effective search space: 226480 Effective search space used: 226480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory