Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_012972803.1 AZL_RS00950 branched-chain amino acid aminotransferase
Query= BRENDA::F2L0W0 (295 letters) >NCBI__GCF_000010725.1:WP_012972803.1 Length = 279 Score = 133 bits (334), Expect = 5e-36 Identities = 90/273 (32%), Positives = 137/273 (50%), Gaps = 7/273 (2%) Query: 4 WLDGRLVDEEEAKVTVLSPSLNYGFGVFEGIRAYWNGENLYVFRLRDHMERLLRSAKIIG 63 W+ G V+ V LS +L VF+G RA+ L H R +RSA ++G Sbjct: 8 WIQGEWVEGNPPIVGPLSHTLWLSSTVFDGARAFQG----VAPDLDLHCARAIRSAHVMG 63 Query: 64 LDVPYTAEELSKAVVETVRANGFKEDLYIRPVAYISKPQISLDVRGLQASVAIAAIPFGK 123 L+ TA E+ + + +R + +LYIRP+ Y ++ + +++ P + Sbjct: 64 LEPMVTAGEIEELCWDGIRRFPKEAELYIRPMFYADDGFVAPAPESTRFVLSVYEDPLPQ 123 Query: 124 YLKVEGVRAAVVSWRRVHTSMMPVMAKATGIYLNSIMAAVEARARGYDEAIMLNAEGKVV 183 G + S RR +M P AKA +Y N+ MA EAR RG+ AIML+A G V Sbjct: 124 ---PTGFAVCISSRRRPIPAMAPTEAKAACLYPNAGMALTEARKRGFQNAIMLDAIGNVA 180 Query: 184 EGSGENIFIVRRGVLMTPPLEDGILEGITRETVISIAGDLGIPLLEKSITREELYAADEA 243 E + NIFIV+ GV+ TP L GITR+ +I++ G+ + E ++T +E+ ADE Sbjct: 181 EFATSNIFIVKGGVVRTPVPNGCFLNGITRQRIIALLRGDGVTVEECTLTPQEVLEADEV 240 Query: 244 FFVGTAAEITPIIEIDGRVLQRGPITQKIAETY 276 F G A+ P+ ++ R L GPI Q+ Y Sbjct: 241 FSTGNHAKCVPVTRVEDRALAAGPIFQRARALY 273 Lambda K H 0.320 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 279 Length adjustment: 26 Effective length of query: 269 Effective length of database: 253 Effective search space: 68057 Effective search space used: 68057 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory