Align acetolactate synthase (EC 2.2.1.6) (characterized)
to candidate WP_086935435.1 AZL_RS17250 oxalyl-CoA decarboxylase
Query= BRENDA::P9WG39 (547 letters) >NCBI__GCF_000010725.1:WP_086935435.1 Length = 580 Score = 226 bits (576), Expect = 2e-63 Identities = 169/551 (30%), Positives = 276/551 (50%), Gaps = 22/551 (3%) Query: 4 DTAPAQTMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGCREEGIRLIDTRHEQTAAFA 63 + APA T +L+ LK + I+ ++ + G + + + EG+R++ RHEQ A A Sbjct: 13 EDAPALT-DGFQLVIDALKLNDINNLYVVPGIPISDLLRMAQAEGMRVVSFRHEQNAGNA 71 Query: 64 AEGWSKVTRVPGVAALTAGPGITNGMSAMAAAQQNQSPLVVLGGRAPA--LRWGMGSLQE 121 A +T+ PGV + PG NG++A+A A N P++++ G + + G +E Sbjct: 72 AAIAGFMTKKPGVCMTVSAPGFLNGLTALANATTNCFPMILISGSSEREIVDLQQGDYEE 131 Query: 122 IDHVPFVAPVARFAATAQSAENAGLLVDQALQAAVSAPSGVAFVDFPMDHAFSMSSDNGR 181 +D + P+ + A A++ G+ V +A++AAVS G ++D P FS D Sbjct: 132 MDQLAIAKPLCKAAFRILHAQDIGIGVARAIRAAVSGRPGGVYLDLPAK-LFSQVMDAAE 190 Query: 182 PGALTELPAGPTPA----GDALDRAAGLLSTAQRPVIMAGTNVWWGHAEAALLRLVEERH 237 PTPA DA++RA LL A+RP+++ G + A+ + VE+ Sbjct: 191 GAKSLVKVVDPTPAQYPSADAVNRALDLLKGAKRPLVIFGKGAAYAQADETIRSFVEKSG 250 Query: 238 IPVLMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMDFRL--GFGGVFG--STT 293 IP L MA+G++P H + ARS L EADV ++VG +++ L G G +G + Sbjct: 251 IPFLQMSMAKGLLPDTHPQSAGAARSLVLQEADVVMLVGARLNWLLSHGKGKTWGKPGSK 310 Query: 294 QLIVADRVEPAREHPRPVAAGLYGDLTATLSAL---AGSGGTDHQGWIEELATAETMARD 350 + I D + + A L GD+ + + L G T W+ +A Sbjct: 311 KFIQVDIEPREMDSNVEIHAPLVGDIASVMEVLLKGIEGGLTPPADWMATVAAKREQNVA 370 Query: 351 LEKAELVDDRIPLHPMRVYAELAALLER--DALVVIDAGDFGSYAGRMIDSYLPGCWLDS 408 +L+ + P++ L +++ DA++V + + A +ID Y P LD Sbjct: 371 KMAPKLMSNASPMNFHGALGALRRVIKERPDAMLVNEGANTLDLARGIIDMYEPRKRLDV 430 Query: 409 GPFGCLGSGPGYALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVI-GNNG 467 G +G +G G GYA+AA + + V+ ++GD AFGFSGME +T+ R+N+ V VI NNG Sbjct: 431 GTWGVMGVGMGYAVAAAV-ESGKPVLAVEGDSAFGFSGMEVETICRYNLPVCIVIFNNNG 489 Query: 468 IW-GLEKHPMEALYGYSVVAELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASGL 526 I+ G + +P +V PG+RYD+++ A GG G V+ P EL A+ A SG Sbjct: 490 IYRGTDTNPTGGADPSPMV--FVPGSRYDKMMEAFGGVGVHVTNPDELYRAVSEAMDSGR 547 Query: 527 PAVVNVLTDPS 537 P ++N + DP+ Sbjct: 548 PTLINAVIDPA 558 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 722 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 547 Length of database: 580 Length adjustment: 36 Effective length of query: 511 Effective length of database: 544 Effective search space: 277984 Effective search space used: 277984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory