Align aspartate semialdehyde dehydrogenase subunit (EC 1.2.1.11) (characterized)
to candidate WP_010936674.1 DET_RS05055 aspartate-semialdehyde dehydrogenase
Query= metacyc::MONOMER-6564 (346 letters) >NCBI__GCF_000011905.1:WP_010936674.1 Length = 338 Score = 348 bits (892), Expect = e-100 Identities = 177/343 (51%), Positives = 244/343 (71%), Gaps = 8/343 (2%) Query: 4 GLHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPES 63 G VA+VGATG VGQ+ +K LE R+F MDT++LL+S RSAG K+ KG+E+ V+E + +S Sbjct: 2 GYRVAIVGATGMVGQEFIKVLEKRDFPMDTVSLLASDRSAGKKMMVKGEEIEVRETAYDS 61 Query: 64 FEGVNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHEHNG 123 F V+IALFSAG +S+ AP A + AIV+DN++AFRMD PLVVPEVN D+ H G Sbjct: 62 FNNVDIALFSAGADISRHFAPIAAQHKAIVVDNSAAFRMDPKVPLVVPEVNIEDITRHKG 121 Query: 124 IIANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEEI 183 IIANPNCSTIQMV AL P+ K + +++V+T+QAVSG G AV EL +QT+ +L+ ++ Sbjct: 122 IIANPNCSTIQMVVALYPLHKVNPIKRIVVTTFQAVSGTGVNAVDELQTQTRQLLDGQKA 181 Query: 184 EPEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAATCVR 243 + +QIAFN +P+ID F D+GYT EE KM+ ET+KIMH ++Q++ATCVR Sbjct: 182 VAHVY-------SHQIAFNVLPEIDVFLDSGYTKEEWKMLEETRKIMHADNIQLSATCVR 234 Query: 244 LPIQTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKNDVFV 303 +P+ TGHSE+V IE +R E +++L +PG+ + D+P+ +LYP P A G ++VFV Sbjct: 235 VPVITGHSEAVTIEFER-PMEPEQARDILLRSPGIKVLDEPAVKLYPHPWLATGTDEVFV 293 Query: 304 GRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV 346 GRIRKD+ NG +WVV+DN+ KGAA N+VQIAE L ++ Sbjct: 294 GRIRKDISNPNGLVMWVVADNVRKGAALNAVQIAEELVNRGMI 336 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 338 Length adjustment: 29 Effective length of query: 317 Effective length of database: 309 Effective search space: 97953 Effective search space used: 97953 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_010936674.1 DET_RS05055 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.1874.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-144 465.4 1.0 6.2e-144 465.2 1.0 1.0 1 lcl|NCBI__GCF_000011905.1:WP_010936674.1 DET_RS05055 aspartate-semialdehy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000011905.1:WP_010936674.1 DET_RS05055 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.2 1.0 6.2e-144 6.2e-144 1 338 [. 4 332 .. 4 333 .. 0.99 Alignments for each domain: == domain 1 score: 465.2 bits; conditional E-value: 6.2e-144 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 +vaivGatG vGqe++kvLe+r+fp+d++ llas+rsaGkk+ +kg+e+ev+e+ sf+++dialfsa lcl|NCBI__GCF_000011905.1:WP_010936674.1 4 RVAIVGATGMVGQEFIKVLEKRDFPMDTVSLLASDRSAGKKMMVKGEEIEVRETAYDSFNNVDIALFSA 72 69******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 G+ +s+ fap aa++ +iv+Dn++afr+d++vPLvvpevn e+++ +k giianPnCstiq+vv+L p lcl|NCBI__GCF_000011905.1:WP_010936674.1 73 GADISRHFAPIAAQHKAIVVDNSAAFRMDPKVPLVVPEVNIEDITRHK--GIIANPNCSTIQMVVALYP 139 ********************************************9988..******************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 l++ +kr+vv t+qavsG+G ++v+eL+ qt+ l+g+ a+ +++qiafn++p id + lcl|NCBI__GCF_000011905.1:WP_010936674.1 140 LHKVNPIKRIVVTTFQAVSGTGVNAVDELQTQTRQLLDGQKAV-------AHVYSHQIAFNVLPEIDVF 201 *************************************998776.......799**************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 + Gytkee k+l etrki++ +++++satcvrvPv+tghse+v+iefe+++++e+++++L +pg++v lcl|NCBI__GCF_000011905.1:WP_010936674.1 202 LDSGYTKEEWKMLEETRKIMHADNIQLSATCVRVPVITGHSEAVTIEFERPMEPEQARDILLRSPGIKV 270 ********************************************************************* PP TIGR01296 277 iddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 +d+p +lyp P a+g+devfvgrirkD+s+ +gl ++vvaDn+rkGaalnavqiae l++ lcl|NCBI__GCF_000011905.1:WP_010936674.1 271 LDEPAVKLYPHPWLATGTDEVFVGRIRKDISNPNGLVMWVVADNVRKGAALNAVQIAEELVN 332 ***********************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 11.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory