Align Ketol-acid reductoisomerase (NAD(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.382 (characterized)
to candidate WP_010936559.1 DET_RS04335 ketol-acid reductoisomerase
Query= SwissProt::K4LVZ1 (332 letters) >NCBI__GCF_000011905.1:WP_010936559.1 Length = 332 Score = 447 bits (1151), Expect = e-130 Identities = 212/328 (64%), Positives = 263/328 (80%) Query: 3 IYYDQDADLQYLDGKTVAVIGYGSQGHAQSQNLRDSGVKVVVADIPSSENWKKAEEAQFQ 62 IYYD+D DL ++ K + ++GYG+QGHA +QNLRDSG+KV+VA + WKKA F+ Sbjct: 4 IYYDKDCDLSLIEKKIIGIVGYGAQGHAHAQNLRDSGLKVIVACVEGGRGWKKATADGFE 63 Query: 63 PLTADEAAREADIIQILVPDEKQAALYRESIAPNLRPGKALVFSHGFNIHFKQIVPPPDV 122 + E A++ADII +L PD QA +Y++S+ L PGK L+F+HGFNIH+ QIVPP V Sbjct: 64 VMCVAEMAKKADIIMMLAPDTSQAKIYKDSVEQGLTPGKMLMFAHGFNIHYGQIVPPSFV 123 Query: 123 DVFMVAPKGPGHLVRRMYEEGAGVPSLVAVEQDYSGQALNLALAYAKGIGATRAGVIQTT 182 DV M+APK PG+++R+++ EGAG PSL+AVEQD SG+A +ALAYAKGIG+ RAGV++TT Sbjct: 124 DVTMIAPKCPGYMLRQVFTEGAGAPSLIAVEQDASGKAKEIALAYAKGIGSNRAGVLETT 183 Query: 183 FKEETETDLFGEQAVLCGGITELIRAGFDTLVDAGYQPEIAYFECLHEMKLIVDLIYEGG 242 F EETETDLFGEQAVLCGG T L++AGF+TLV+AGYQPE+AYFECLHE+KLIVDL+Y+GG Sbjct: 184 FAEETETDLFGEQAVLCGGTTSLVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYQGG 243 Query: 243 ISTMRYSISDTAEYGDLTRGKRIITEATREEMKKILKEIQDGVFAREWLLENQVGRPVYN 302 I+ MR SISDTA+YGD TRG R+I E T E M +IL EIQDG FA+EW+LENQ GRPVYN Sbjct: 244 IAYMRDSISDTAKYGDFTRGPRVINEETYETMGEILGEIQDGSFAKEWILENQAGRPVYN 303 Query: 303 ALRRKEQNHLIETVGARLRGMMPWLKKK 330 +LRR E HLIE VGA LR MM WLKKK Sbjct: 304 SLRRMESEHLIEEVGAELRSMMSWLKKK 331 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 332 Length adjustment: 28 Effective length of query: 304 Effective length of database: 304 Effective search space: 92416 Effective search space used: 92416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_010936559.1 DET_RS04335 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.9062.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-141 456.3 0.6 2.7e-141 456.0 0.6 1.0 1 lcl|NCBI__GCF_000011905.1:WP_010936559.1 DET_RS04335 ketol-acid reductois Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000011905.1:WP_010936559.1 DET_RS04335 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.0 0.6 2.7e-141 2.7e-141 2 314 .] 16 329 .. 15 329 .. 0.99 Alignments for each domain: == domain 1 score: 456.0 bits; conditional E-value: 2.7e-141 TIGR00465 2 kgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDe 70 ++k ++i+GyG+qG+a+a nlrdsgl+viv+ +++ wkkA+ dGf+v+ v+e++kkad+im+L pD+ lcl|NCBI__GCF_000011905.1:WP_010936559.1 16 EKKIIGIVGYGAQGHAHAQNLRDSGLKVIVACVEGGRGWKKATADGFEVMCVAEMAKKADIIMMLAPDT 84 67889**************************************************************** PP TIGR00465 71 vqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAv 139 q + y+ ++++ l+ gk+l+f+HGfni++ qiv+p vdv+++APK+pG ++R+ + eg+G psliAv lcl|NCBI__GCF_000011905.1:WP_010936559.1 85 SQAKIYKDSVEQGLTPGKMLMFAHGFNIHYGQIVPPSFVDVTMIAPKCPGYMLRQVFTEGAGAPSLIAV 153 ********************************************************************* PP TIGR00465 140 eqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpe 208 eqd++g+akeiAlayAk+iG++ragvlettF eE+e+DLfGEqavLcGg + l+ka+f+tLveaGyqpe lcl|NCBI__GCF_000011905.1:WP_010936559.1 154 EQDASGKAKEIALAYAKGIGSNRAGVLETTFAEETETDLFGEQAVLCGGTTSLVKAGFETLVEAGYQPE 222 ********************************************************************* PP TIGR00465 209 lAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefakew 276 +Ayfe++helklivdl++++G+++mrd++s+tAk+g+++++ ++++ee+ ++m +il eiq+G+fakew lcl|NCBI__GCF_000011905.1:WP_010936559.1 223 VAYFECLHELKLIVDLMYQGGIAYMRDSISDTAKYGDFTRGpRVINEETYETMGEILGEIQDGSFAKEW 291 ********************************************************************* PP TIGR00465 277 alekeagkpafeearkkekeqeiekvGkelralvkaek 314 +le++ag+p +++ r++e+e+ ie+vG elr ++++ k lcl|NCBI__GCF_000011905.1:WP_010936559.1 292 ILENQAGRPVYNSLRRMESEHLIEEVGAELRSMMSWLK 329 **********************************9865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (332 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.63 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory