Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_010937030.1 DET_RS06870 aminotransferase class V-fold PLP-dependent enzyme
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000011905.1:WP_010937030.1 Length = 398 Score = 159 bits (403), Expect = 1e-43 Identities = 107/356 (30%), Positives = 170/356 (47%), Gaps = 7/356 (1%) Query: 34 VNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDA 93 ++L G+P P +R +A AL Y+ G+ ELR IA + + + P+ Sbjct: 39 ISLGVGEPDFTTPWHIRESAIYALEKGYTMYTSNAGLLELRQEIAKYLYQTYKLEYNPET 98 Query: 94 -VVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQP 152 ++IT GSS L A + GD V M P Y Y + + V+IP F+ Sbjct: 99 EILITVGSSEALDLVMRATLNPGDEVLMTDPAYVAYPSCVFMAYGNPVQIPTFEANNFEI 158 Query: 153 TAQMLA-EIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQ 211 +A +A I P R +++ P+NPTG V+P +LA IA ++ ++SDE+Y ++Y Sbjct: 159 SAADIAPRITPKTRSILLGYPSNPTGAVMPKAKLAEIAKLACEKNLLVVSDEIYDKIIYS 218 Query: 212 GAPQTSCAWQTS--RNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPV 269 G T A +V++N FSK YAMTGWR+G+ P + +A+ + + +C P+ Sbjct: 219 GFEHTCFATLPGMRERSVIINGFSKTYAMTGWRIGYAAGPADIIQAMTKIHQHTMLCAPI 278 Query: 270 LSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDF 329 +Q AA+ A + + Y R ++ +G+ P GAFY + V Sbjct: 279 AAQKAALEAL-KNGHDDVRLMVEEYDRRRRFIVKSFNDMGLSCFEP-KGAFYTFPSVKKT 336 Query: 330 TSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRIGSWL 385 S F KLL + VA PG F + G ++R +A D+EEA++R +L Sbjct: 337 GLSSAEFAEKLLLEETVAAVPGTAFGDS-GEGYLRCCYATSMKDLEEAMKRFRHFL 391 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 398 Length adjustment: 31 Effective length of query: 357 Effective length of database: 367 Effective search space: 131019 Effective search space used: 131019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory