Align Metal-independent phosphoserine phosphatase; iPSP; Phosphoglycerate mutase-like protein 3; EC 3.1.3.3 (characterized)
to candidate WP_004513838.1 GMET_RS02345 alpha-ribazole phosphatase
Query= SwissProt::F4KI56 (238 letters) >NCBI__GCF_000012925.1:WP_004513838.1 Length = 201 Score = 75.1 bits (183), Expect = 1e-18 Identities = 59/165 (35%), Positives = 83/165 (50%), Gaps = 10/165 (6%) Query: 25 TEIVLVRHGETTWNAAG---RIQGQIESDLNEVGLKQAVAIAERLGKEERPV-AVYSSDL 80 T I L+RHGE AG R G + L+E G Q AI ER + P+ A+Y+SDL Sbjct: 5 TRIHLIRHGEV--EGAGPVRRYNGHTDVALSERGRSQYHAIKERFA--DAPITALYTSDL 60 Query: 81 KRAKDTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLE 140 +R A ++ V + P+L+E VG +G W E E+ P + A + Sbjct: 61 RRCAWGAEVLGSHLGLTPVRK-PELREMGVGIWEGKSWPELMEQYPAEWQARLDDIVNYR 119 Query: 141 IPGGGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYL 185 +P G ES + R M + I ++H+GE V+VV HGGV R I L Sbjct: 120 VPQG-ESVLDVHGRVMPVINDIVERHRGEEVLVVAHGGVNRIILL 163 Lambda K H 0.315 0.132 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 201 Length adjustment: 22 Effective length of query: 216 Effective length of database: 179 Effective search space: 38664 Effective search space used: 38664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory