Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_011372501.1 SUDEN_RS04580 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::F5A7Q0 (429 letters) >NCBI__GCF_000012965.1:WP_011372501.1 Length = 428 Score = 319 bits (818), Expect = 9e-92 Identities = 176/412 (42%), Positives = 253/412 (61%), Gaps = 9/412 (2%) Query: 19 IPGDKSISHRAVMFGSIAEGKTTIKGFLSGADCLSTISCFKEMGVEITQNGDEVTVVGKG 78 I DKSISHR MF +A+G + I FL D ++++ K +G I +G+ + + Sbjct: 19 IASDKSISHRCAMFAMLADGTSQITNFLRAEDTMNSLKIVKNLGATIDDDGETIKISS-- 76 Query: 79 LEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDESIAKRPMKRVTNPLKQMGAN 138 +G++E VLD GNSGT +RL G+L++ + GDE + +RPMKR+T PL+ +GA Sbjct: 77 -DGIKESSEVLDCGNSGTGMRLFCGLLSSADGHFVLSGDEYLRRRPMKRITAPLRDIGAK 135 Query: 139 IDGREEGTFTPLTIRGGDLKAIEYISPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHT 198 +DGRE G PL+IRG LKA Y S +ASAQVKSA++LA LRA+G + +EP +SRDHT Sbjct: 136 LDGRENGDLAPLSIRGASLKAFNYESKIASAQVKSAMILAALRADGECSFSEPELSRDHT 195 Query: 199 ERMLEAFGVKVTREGKTVKLSGGQK-LTATNIQVPGDVSSAAFFLVAGAIIPNSKLVLQN 257 ERML+ G ++ EG K+ +K L+ I+VP D SSA FF VA AI PNS +VL+ Sbjct: 196 ERMLKGMGAEIEVEGLITKIKPMKKLLSPLKIRVPADPSSAFFFAVAAAITPNSNVVLEG 255 Query: 258 VGMNPTRTGIIDVLEKMGATFTVDLINEGASEPAANITIETSSLKGIEIGGDIIPRLIDE 317 V +NPTR LE+MGA + E EP NI ++ + LK I + D I LIDE Sbjct: 256 VTLNPTRIEAFKALERMGADIRYE-ATENIYEPIGNIHVKYAPLKAITV-EDNISWLIDE 313 Query: 318 IPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSAL 377 +P +++A A+G++++K+A EL+VKE++RI TVV L G ++ DG + G L Sbjct: 314 LPALSIAFACADGVSIVKNAQELRVKESDRISTVVNGLKACGIEVDEVHDGYSVKG-GVL 372 Query: 378 KGNTVNSYGDHRIGMMLAIAGCLAEGKTIIEDAEAVGVSYPTFFDELQKLAK 429 K ++S+GDHRI M IAG + ++D + S+P FF+ L+K+ K Sbjct: 373 KEAKIDSHGDHRIAMSFIIAGVTCGMR--VDDIACINTSFPNFFELLKKITK 422 Lambda K H 0.315 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 428 Length adjustment: 32 Effective length of query: 397 Effective length of database: 396 Effective search space: 157212 Effective search space used: 157212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
Align candidate WP_011372501.1 SUDEN_RS04580 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.5403.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-126 406.6 0.1 6.5e-126 406.4 0.1 1.0 1 lcl|NCBI__GCF_000012965.1:WP_011372501.1 SUDEN_RS04580 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011372501.1 SUDEN_RS04580 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.4 0.1 6.5e-126 6.5e-126 4 414 .. 18 422 .. 16 423 .. 0.96 Alignments for each domain: == domain 1 score: 406.4 bits; conditional E-value: 6.5e-126 TIGR01356 4 kipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgglkepeae 72 +i+++KSishR ++a La+g++++tn+L++eDt ++l+++++lGa++ +++e+++i g +ke++++ lcl|NCBI__GCF_000012965.1:WP_011372501.1 18 EIASDKSISHRCAMFAMLADGTSQITNFLRAEDTMNSLKIVKNLGATIDDDGETIKISSDG-IKESSEV 85 5789**********************************************9********87.8****** PP TIGR01356 73 ldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlaisgplk 141 ld+gnsGt +Rl g+l+ a+g++vl+gde l++RP++r++ +Lr +ga+ + +e+ + +Pl+i+g + lcl|NCBI__GCF_000012965.1:WP_011372501.1 86 LDCGNSGTGMRLFCGLLSSADGHFVLSGDEYLRRRPMKRITAPLRDIGAKLDGRENGDLAPLSIRGASL 154 ******************************************************************766 PP TIGR01356 142 ggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeederkivvk 210 + + s+ aS+Q+ksa++laa l+a+++ e+++sr+++e++Lk ++++ +e+e ++k lcl|NCBI__GCF_000012965.1:WP_011372501.1 155 KAFNYESKIASAQVKSAMILAA---LRADGECSFSEPELSRDHTERMLKGMGAE---IEVEGL-ITKIK 216 6*********************...77778888888****************88...777766.88999 PP TIGR01356 211 ggqkykqk.evevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGadveveeqr. 276 + +k ++ +++v++D+SsA+ff++aaait++ +v++e+++ n+t+ + ++ Le+mGad+++e+++ lcl|NCBI__GCF_000012965.1:WP_011372501.1 217 PMKKLLSPlKIRVPADPSSAFFFAVAAAITPNsNVVLEGVTLNPTRIE--AFKALERMGADIRYEATEn 283 999955555***************************************..677**************** PP TIGR01356 277 ......dvevegasklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeL 339 ++ v+ lk+++v+ +++ liDelp+l+++ a+A+g++ +kn++elRvkEsdRi+ +++ L lcl|NCBI__GCF_000012965.1:WP_011372501.1 284 iyepigNIHVK-YAPLKAITVEDNISWLIDELPALSIAFACADGVSIVKNAQELRVKESDRISTVVNGL 351 ***********.568****************************************************** PP TIGR01356 340 eklGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfev 408 ++ G+ev+e +dg +++G+ lk+a++d+++DHRiam++ ++g+ + ++++d +c+++sfP+Ffe+ lcl|NCBI__GCF_000012965.1:WP_011372501.1 352 KACGIEVDEVHDGYSVKGG--VLKEAKIDSHGDHRIAMSFIIAGVTCG--MRVDDIACINTSFPNFFEL 416 *******************..6*************************6..******************* PP TIGR01356 409 leqlga 414 l+++++ lcl|NCBI__GCF_000012965.1:WP_011372501.1 417 LKKITK 422 **9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (428 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.27 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory