Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate YP_427543.1 Rru_A2456 D-3-phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000013085.1:YP_427543.1 Length = 411 Score = 410 bits (1054), Expect = e-119 Identities = 203/406 (50%), Positives = 285/406 (70%), Gaps = 3/406 (0%) Query: 227 SYPKSRINVLLLENVHPIGVEIMKQEGY-NVEVVSSAMSEEELCEKIKNVSIIGIRSKTQ 285 S PK +I V+L EN+H VE GY N+E ++ A+ E L +KI++ ++GIRS+T+ Sbjct: 5 SLPKDKIRVVLFENIHDSAVEYFHSRGYHNIERLTGALDGEALKDKIRDAHMVGIRSRTR 64 Query: 286 ITKKVLENANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLM 345 +T+ VLE+A +LMAVG FCIGTNQ+DL+ + GI VFNAP+SNTRSV EL ++E + +M Sbjct: 65 LTRDVLESAEKLMAVGCFCIGTNQVDLDAAELLGIPVFNAPYSNTRSVAELVVAEAVMMM 124 Query: 346 RNLHDKTLKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYDIVE 405 R++ + H+G WNK+A+G EVRGK LGI+GYG+IG Q+SVLAE+MGM+V Y+DIVE Sbjct: 125 RDIPRRNWDTHEGGWNKAATGCHEVRGKTLGIVGYGHIGTQVSVLAESMGMSVRYFDIVE 184 Query: 406 RLALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVV 465 +LA+GNA +L+EL+ D+++LHV + ++++ +I MK GA L+N SRG VV Sbjct: 185 KLAIGNAQPCATLNELMAVADVVTLHVPDTADTRDMIRAPQIAAMKDGAYLINASRGKVV 244 Query: 466 DVPALRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENI 525 D+ AL +AL +G L GAAVDVFP EP + +PFES L G N +LTPHIGGST EAQ I Sbjct: 245 DIDALAEALTAGKLRGAAVDVFPKEPASLGDPFESPLRGMRNVLLTPHIGGSTEEAQMGI 304 Query: 526 AQFVPGKIIEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASYKI 585 + V K+++Y + G+T +VNFP + LP R +HIH+N PGV++ +N+V +S+ I Sbjct: 305 GREVAEKLVKYSDDGSTLGAVNFPEVALPQQASVTRFLHIHRNVPGVMSALNEVFSSHHI 364 Query: 586 NIVGQYLKTNEKIGYVITDIDK--RYSNDVIDALKEIEGTIRFRIL 629 NI GQYL TN ++GYV+ D++K + AL I GT+RFR L Sbjct: 365 NIRGQYLMTNPRVGYVVVDVEKDLKAGEGFRQALAAINGTLRFRFL 410 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 411 Length adjustment: 34 Effective length of query: 596 Effective length of database: 377 Effective search space: 224692 Effective search space used: 224692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory