Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_011444387.1 SARO_RS03630 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_000013325.1:WP_011444387.1 Length = 283 Score = 97.4 bits (241), Expect = 4e-25 Identities = 84/268 (31%), Positives = 126/268 (47%), Gaps = 32/268 (11%) Query: 97 IIAGPCSVEGREMLMETAHFLSELGVKVLRGGAYKP------RTSPYSFQGLG-EKGLEY 149 +I+GPC +EG ++ + A L+ L K+ +K RTS SF+G G E+GL Sbjct: 16 LISGPCVIEGLDLCLGMAEALARLADKLDIAIVFKASFDKANRTSAASFRGPGLERGLRI 75 Query: 150 LREAADKYGMYVVTEALGEDDLPKVAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLKRG 209 L + G+ V+T+ +VAE D +Q A A+ L+ A + +PV LK+ Sbjct: 76 LESVKRESGLPVLTDVHEAGHCAEVAEVVDFLQTPAFLARQTDLIEAAAATGRPVNLKKA 135 Query: 210 FMNTIEEFLL------SAEYIANSGNTKIILCERGIR------TFEKATRNTLDISAVPI 257 + L A A G + +CERG + + + L + P+ Sbjct: 136 QFMAPADMLAVVDKARMASQRAGHGAGSLAVCERGTAFGYGNLVVDMRSLDELRATGCPV 195 Query: 258 IRKESHLPILVDP--SHSGGRRDLVIPLSRAAIAVGAHGIIVEVHPEPEKALSDGKQSLD 315 I +H L S SGG+R V L+RAA+AVG G+ +E HP+P++ALSDG SL Sbjct: 196 IFDATHSVQLPGALGSCSGGQRRHVPTLARAAVAVGVDGLFLECHPDPDRALSDGPNSLA 255 Query: 316 F----ELFKELVQ-------EMKKLADA 332 L + LV+ E K+L DA Sbjct: 256 LADVGPLMRVLVEIDAARRAERKELTDA 283 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 283 Length adjustment: 27 Effective length of query: 311 Effective length of database: 256 Effective search space: 79616 Effective search space used: 79616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory