Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate WP_011911792.1 PST_RS02880 3-dehydroquinate synthase
Query= SwissProt::Q8RU74 (442 letters) >NCBI__GCF_000013785.1:WP_011911792.1 Length = 367 Score = 420 bits (1080), Expect = e-122 Identities = 218/358 (60%), Positives = 266/358 (74%), Gaps = 5/358 (1%) Query: 81 VEVDLGTRSYPIYIGAGLLDQPDLLQRHIHGKRVLVVTNTTVAPLYLDKTISALTDGNPN 140 ++VDLG RSYPI+IG L+D+ DL I G++V +VTN TVAPLYLD+ S L+ Sbjct: 4 LQVDLGERSYPIHIGERLIDRSDLFASKIRGRQVAIVTNETVAPLYLDRLTSTLS----G 59 Query: 141 VTVESVILPDGEQFKNMETLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASYLRG 200 +V +ILPDGE KN ETL +FD + +R DR T VALGGGVIGDM G+AAASY RG Sbjct: 60 YSVTPIILPDGESHKNWETLQLIFDALLGARHDRNTTVVALGGGVIGDMAGFAAASYQRG 119 Query: 201 VNFIQIPTTVMAQVDSSVGGKTGINHPLGKNMIGAFYQPQCVLIDTDTLNTLPDRELASG 260 V+FIQ+PTT+++QVDSSVGGKTGINHPLGKNMIGAFYQP+ V+IDT TL TLP REL++G Sbjct: 120 VDFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPRAVVIDTATLATLPSRELSAG 179 Query: 261 LAEVIKYGLIRDAEFFEWQEQNMPLLLARDPTAFTYAIKRSCENKADVVSQDEKESGVRA 320 LAEVIKYGLI D F W E N+ + + D A T AI RSC KA VV+ DE+ESGVRA Sbjct: 180 LAEVIKYGLICDEPFLTWLEANIDRIRSLDSLALTEAIHRSCAAKAKVVNADERESGVRA 239 Query: 321 TLNLGHTFGHAVETGVGYGQWLHGEAVAAGTVMAVDMSRRLGWIDDSLVQRVQKILQQAK 380 TLNLGHTFGHA+ET +GYG WLHGEAV+AGTVMA++MS +LGWI + R ++LQ+A Sbjct: 240 TLNLGHTFGHAIETHMGYGVWLHGEAVSAGTVMALEMSSQLGWIGQADRDRAIRLLQRAG 299 Query: 381 LPTSPPETMTVEMFKSIMAVDKKVADGKLRLILLKGSLGNCVFTGDYDQKALDETLRA 438 LP PP M + F MAVDKKV DG+LRL+LL+ +G V TGD+ + L+ TL A Sbjct: 300 LPVVPPAEMQPQDFLEHMAVDKKVLDGRLRLVLLR-QMGEAVVTGDFPRGVLETTLSA 356 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 367 Length adjustment: 31 Effective length of query: 411 Effective length of database: 336 Effective search space: 138096 Effective search space used: 138096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011911792.1 PST_RS02880 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.25605.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-120 388.2 0.0 2.2e-120 387.9 0.0 1.0 1 lcl|NCBI__GCF_000013785.1:WP_011911792.1 PST_RS02880 3-dehydroquinate syn Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013785.1:WP_011911792.1 PST_RS02880 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 387.9 0.0 2.2e-120 2.2e-120 1 334 [. 13 345 .. 13 354 .. 0.96 Alignments for each domain: == domain 1 score: 387.9 bits; conditional E-value: 2.2e-120 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletv 68 y++++ge l+++ ++ + +++ ++t+e+v+ l+ ++l ++l+ g++v+ +++pdge++K++et+ lcl|NCBI__GCF_000013785.1:WP_011911792.1 13 YPIHIGERLIDRSDLFASKiRGRQVAIVTNETVAPLYLDRLTSTLS--GYSVTPIILPDGESHKNWETL 79 6899****999655555555679*********************95..8******************** PP TIGR01357 69 aklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplg 137 + + d+ll + ++r++++va+GGGv+gD+aGF+Aa+y+RG++++qvPTtll++vDssvGGKtgin+plg lcl|NCBI__GCF_000013785.1:WP_011911792.1 80 QLIFDALLGARHDRNTTVVALGGGVIGDMAGFAAASYQRGVDFIQVPTTLLSQVDSSVGGKTGINHPLG 148 ********************************************************************* PP TIGR01357 138 kNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeel 206 kN+iGafyqP+aV+id+++l+tlp+rel++G+aEviK+gli d+ ++++le n + +++l + al+e+ lcl|NCBI__GCF_000013785.1:WP_011911792.1 149 KNMIGAFYQPRAVVIDTATLATLPSRELSAGLAEVIKYGLICDEPFLTWLEANIDRIRSL-DSLALTEA 216 *******************************************************88875.5599**** PP TIGR01357 207 ikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllka 274 i rs+ Ka+vV++De+esg+Ra+LN+GHt+gHaiE+ ++y+ + HGeaV+ G v+++++s +lg + + lcl|NCBI__GCF_000013785.1:WP_011911792.1 217 IHRSCAAKAKVVNADERESGVRATLNLGHTFGHAIETHMGYGvWLHGEAVSAGTVMALEMSSQLGWIGQ 285 ********************************************************************* PP TIGR01357 275 ellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasev 334 +++r ++ll+++glp+ + +++ + +l+++ DKK +++++lvll+++G+a+++ ++ lcl|NCBI__GCF_000013785.1:WP_011911792.1 286 ADRDRAIRLLQRAGLPVVPPAEMQPQDFLEHMAVDKKVLDGRLRLVLLRQMGEAVVTGDF 345 *****************************************************9988666 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory