Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_011610169.1 TERY_RS01355 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000014265.1:WP_011610169.1 Length = 390 Score = 186 bits (473), Expect = 8e-52 Identities = 120/391 (30%), Positives = 197/391 (50%), Gaps = 11/391 (2%) Query: 4 RVALRAGVPPFYVMDVWLAAAERQRTHG-DLVNLSAGQPSAGAPEPVRAAAAAALHLNQL 62 ++A R G P + A A + G D+ + SAG+P PE ++ AA AL Sbjct: 2 KLAARVGKVPLSLTLAISAKARAMKADGKDVCSFSAGEPDFDTPEHIKVAAQKALDSGYT 61 Query: 63 GYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMAS 122 Y A G P+LR+AIA + +G+ + + +++T G LA + GD V + + Sbjct: 62 KYGPAAGEPKLREAIAHKLSQENGLNYKAENIIVTNGGKHSLFNLMLALIEPGDEVIIPA 121 Query: 123 PGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIP 181 P + Y ++ G E + + P+T ++ T + L + I + V+ SP+NPTG V Sbjct: 122 PYWLSYPEMVKLAGGEPIILTTDPETGYKVTPEQLRQSITDKTKLFVLNSPSNPTGMVYQ 181 Query: 182 PEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTS---RNAVVVNSFSKYYAM 238 P E+ A+A D+ ++SDE+Y ++Y A S S +N ++ N F+K Y+M Sbjct: 182 PAEIKALAEVLVEKDILVVSDEIYEKIIYDDAEHLSIGAVNSEIFKNTIISNGFAKAYSM 241 Query: 239 TGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINR 298 TGWR+G+L P L A + G+ T +Q A++A + ++A R Sbjct: 242 TGWRIGYLAAPVELINATVKIQGHSTSNVCTFAQYGAIAALESSQDC-VEQMRQAFAKRR 300 Query: 299 SLLLDGLRRI-GIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTA 357 ++ D L+ + GI P +GAFY++ ++S +S SL FC+ LL D VA+ PGI F Sbjct: 301 KIIYDLLKTLPGISCNQP-EGAFYMFVNISKISSSSLEFCNALLEDQNVAVIPGIAFG-- 357 Query: 358 RGGSFVRISFAGPSGDIEEALRRIGSWLPSQ 388 +RIS+A IE+ + R+ ++ SQ Sbjct: 358 -ADDHIRISYATDLETIEKGMDRLERFIRSQ 387 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 390 Length adjustment: 30 Effective length of query: 358 Effective length of database: 360 Effective search space: 128880 Effective search space used: 128880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory