Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_011735906.1 PPRO_RS10085 glycerate dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >NCBI__GCF_000015045.1:WP_011735906.1 Length = 331 Score = 75.9 bits (185), Expect = 1e-18 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 3/145 (2%) Query: 130 LQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATEGFDEVAT-LEALPTLMARAD 188 L G L ++G GS + +A+ A FGM+V + + + ++ L L L AD Sbjct: 149 LNGLTLGVVGYGSTGQAVARIANAFGMRV--LVHAQRIPRHLGQLPVRLVPLEELFETAD 206 Query: 189 AIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALERQLRQHPQQQAVLDV 248 I+ P T G +N +LARMKP ++L N RG +++ L+R LR A LDV Sbjct: 207 VISLNCPQTRENSGFVNAGLLARMKPSSLLINTSRGGLINEADLDRALRDGIIAGAGLDV 266 Query: 249 FNQEPLPEDHPIWGLGNVIVTPHIA 273 EP D+P+ N I+TPH+A Sbjct: 267 LAHEPPRGDNPLLSAPNCIITPHLA 291 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 331 Length adjustment: 28 Effective length of query: 280 Effective length of database: 303 Effective search space: 84840 Effective search space used: 84840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory