Align Phosphoserine aminotransferase, chloroplastic; PSAT; Phosphohydroxythreonine aminotransferase; EC 2.6.1.52 (characterized)
to candidate WP_011734678.1 PPRO_RS03600 3-phosphoserine/phosphohydroxythreonine transaminase
Query= SwissProt::P52877 (430 letters) >NCBI__GCF_000015045.1:WP_011734678.1 Length = 364 Score = 344 bits (882), Expect = 3e-99 Identities = 188/371 (50%), Positives = 246/371 (66%), Gaps = 15/371 (4%) Query: 67 ERVFNFAAGPAVLPENVLQKAQSELLNWRGSGMSVMEMSHRGKEFTSIIDKAEADLRTLL 126 +R +NF+AGP++LPE+VL KA E+L + SG SVMEMSHR K F +II AEA +R + Sbjct: 2 KRFYNFSAGPSMLPESVLAKAADEMLCYETSGQSVMEMSHRSKPFEAIIAGAEALVRQNM 61 Query: 127 NIPSDYTVLFLQGGASTQFSAIPLNLCTPDSAVDYIVTGSWGDKAAKEAAKYAAVSSIWS 186 IP DY VLFLQGGAS QF +PLN T + D+ +TG+W KAA+EA + + + S Sbjct: 62 AIPDDYHVLFLQGGASLQFHMLPLNFMTINKKADFTLTGTWAQKAAEEAKRLGTANIVGS 121 Query: 187 GKSDNYVRIPNFDGSEFVQNSQARYLHICANETIYGVEFKKYP-VPANPDGFLVADMSSN 245 K + +P G++ +A Y HIC N TI G ++ P V A P L+ D+SS Sbjct: 122 SKDKKWSYLPEITGAD----PEADYFHICYNNTIEGTQYHSIPEVGAVP---LIGDISSG 174 Query: 246 FCSKPVDVTKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQKMTPVMLDYKIHADNKSLY 305 S P+DVT+F ++YAGAQKN+GP+GVT+VI+R D++ P ML YK H D S+Y Sbjct: 175 VLSAPLDVTRFAVLYAGAQKNLGPAGVTLVIIRKDMMERIPAGLPAMLSYKTHVDGGSMY 234 Query: 306 NTPPCYGIYMCGLVFEDLLNQGGLVEVEKKNKAKAQVLYDAIDESNGFYKCPVEKSVRSL 365 NTPPCY IY+ LV E + + GG + ++N+ KA++LYD +D S+ F+ PVEKSVRSL Sbjct: 235 NTPPCYAIYIFKLVQEWIRDMGGAEVIYRQNQEKARLLYDFLDSSSLFFS-PVEKSVRSL 293 Query: 366 MNVPF-TLEK-----SELEGDFIKEAAKEKMVALKGHRSVGGMRASIYNAMPLAGVEKLV 419 MNVPF T EK L F+KE+ +V L GHRSVGGMRASIYNAMPL GV+ LV Sbjct: 294 MNVPFLTTEKDADKAEALNKKFVKESEAAGLVNLAGHRSVGGMRASIYNAMPLEGVQALV 353 Query: 420 AFMKEFQAKHA 430 AFMKEF+A+ A Sbjct: 354 AFMKEFEARCA 364 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 364 Length adjustment: 31 Effective length of query: 399 Effective length of database: 333 Effective search space: 132867 Effective search space used: 132867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011734678.1 PPRO_RS03600 (3-phosphoserine/phosphohydroxythreonine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.26590.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-145 468.2 0.0 8.8e-145 468.0 0.0 1.0 1 lcl|NCBI__GCF_000015045.1:WP_011734678.1 PPRO_RS03600 3-phosphoserine/pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015045.1:WP_011734678.1 PPRO_RS03600 3-phosphoserine/phosphohydroxythreonine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.0 0.0 8.8e-145 8.8e-145 2 356 .. 5 361 .. 4 363 .. 0.97 Alignments for each domain: == domain 1 score: 468.0 bits; conditional E-value: 8.8e-145 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflq 70 +nFsaGP++lpe+vl+ka++e+l ++ +g svme+sHRsk fe+++ ae +r+ + ipd+y+vlflq lcl|NCBI__GCF_000015045.1:WP_011734678.1 5 YNFSAGPSMLPESVLAKAADEMLCYETSGQSVMEMSHRSKPFEAIIAGAEALVRQNMAIPDDYHVLFLQ 73 8******************************************************************** PP TIGR01364 71 GGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelked 139 GGa+ qf ++pln+++ +k+ad+ tG+w++ka++eak+l++ +++v s+++kk+s +p+ +++ lcl|NCBI__GCF_000015045.1:WP_011734678.1 74 GGASLQFHMLPLNFMTINKKADFTLTGTWAQKAAEEAKRLGT-ANIVGSSKDKKWSYLPEI--TGADPE 139 ****************************************99.99**************55..566789 PP TIGR01364 140 aayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrk 208 a+y+++c n+tieG++++++pev +pl+ D+ss +ls ++dv++++++yaGaqKn+GpaGvt+vi+rk lcl|NCBI__GCF_000015045.1:WP_011734678.1 140 ADYFHICYNNTIEGTQYHSIPEVGAVPLIGDISSGVLSAPLDVTRFAVLYAGAQKNLGPAGVTLVIIRK 208 99******************************************************************* PP TIGR01364 209 dllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeaid 277 d++er+ + lp +l+Yk++++ s+yntpp++aiy+++lv +w+++ GG + + ++nqeKa+llY+ +d lcl|NCBI__GCF_000015045.1:WP_011734678.1 209 DMMERIPAGLPAMLSYKTHVDGGSMYNTPPCYAIYIFKLVQEWIRDMGGAEVIYRQNQEKARLLYDFLD 277 ********************************************************************* PP TIGR01364 278 esegfyknkvekkaRslmnvvFtlkke......elekeFlkeaeekglvslkGhrsvGGiRasiYnalp 340 +s+ ++ ++vek+ Rslmnv+F ++++ l+k+F+ke+e++glv+l GhrsvGG+RasiYna+p lcl|NCBI__GCF_000015045.1:WP_011734678.1 278 SSS-LFFSPVEKSVRSLMNVPFLTTEKdadkaeALNKKFVKESEAAGLVNLAGHRSVGGMRASIYNAMP 345 887.8889**************887766788888*********************************** PP TIGR01364 341 leevqaLvdfmkeFek 356 le+vqaLv+fmkeFe+ lcl|NCBI__GCF_000015045.1:WP_011734678.1 346 LEGVQALVAFMKEFEA 361 **************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory