Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_041750362.1 BBTA_RS05605 homoserine O-acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >NCBI__GCF_000015165.1:WP_041750362.1 Length = 404 Score = 533 bits (1372), Expect = e-156 Identities = 259/367 (70%), Positives = 305/367 (83%), Gaps = 2/367 (0%) Query: 16 RFPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPG 75 +F A++PL+LD G + +IAYQTYG+LNADKSNAVLICHALTGDQHVA+ HP TGKPG Sbjct: 33 QFGADKPLKLDCGVDLSPFQIAYQTYGELNADKSNAVLICHALTGDQHVANRHPVTGKPG 92 Query: 76 WWQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRA 135 WW+ LVG G+PLDP+R+FI+CSNVIGGCMGSTGPAS+NPATGK +GL FP+ITI DMVRA Sbjct: 93 WWETLVGKGRPLDPSRYFIVCSNVIGGCMGSTGPASLNPATGKVWGLDFPIITIPDMVRA 152 Query: 136 QAMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVG 195 QAML+ LG++TLFAVVGGSMGGMQ QW V YP+R+F+ + +A A+RHSAQNIAFHE+G Sbjct: 153 QAMLIDHLGIDTLFAVVGGSMGGMQALQWTVAYPQRVFATLAIACATRHSAQNIAFHELG 212 Query: 196 RQAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-RDGLSWG 254 RQA+MADPDW G Y + GV P +GLAVARMAAHITYLS+ AL RKFGR +Q R+ ++ Sbjct: 213 RQAVMADPDWDHGRYGDKGVHPHRGLAVARMAAHITYLSDAALHRKFGRRMQDRELPTFS 272 Query: 255 FDADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGVLAKAFTRARNVRFC 314 FDADFQVESYLR+QGSSFV+RFDANSYLY+TRAMDYFDIAA H GVLA AF R RFC Sbjct: 273 FDADFQVESYLRYQGSSFVERFDANSYLYLTRAMDYFDIAADHDGVLAAAF-RGIKTRFC 331 Query: 315 VLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFLAS 374 V+SF+SDWL+PT+E+R LV AL A+ AR +FAEIE+DKGHDAFLLD P FL S Sbjct: 332 VVSFTSDWLFPTSESRALVHALNASSARVSFAEIETDKGHDAFLLDVPEFFDIASAFLDS 391 Query: 375 AERDRGL 381 A + RGL Sbjct: 392 AGKARGL 398 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 404 Length adjustment: 31 Effective length of query: 351 Effective length of database: 373 Effective search space: 130923 Effective search space used: 130923 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_041750362.1 BBTA_RS05605 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.25394.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-151 489.6 0.0 2.9e-151 489.4 0.0 1.0 1 lcl|NCBI__GCF_000015165.1:WP_041750362.1 BBTA_RS05605 homoserine O-acetyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015165.1:WP_041750362.1 BBTA_RS05605 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 489.4 0.0 2.9e-151 2.9e-151 2 350 .. 37 389 .. 36 390 .. 0.98 Alignments for each domain: == domain 1 score: 489.4 bits; conditional E-value: 2.9e-151 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgrald 69 +++l+l++G ls +++ay+tyG+lna+++Navl+cHaltg++hva+++ + k GWW++l+G+gr+ld lcl|NCBI__GCF_000015165.1:WP_041750362.1 37 DKPLKLDCGVDLSPFQIAYQTYGELNADKSNAVLICHALTGDQHVANRHPVTGKpGWWETLVGKGRPLD 105 689*********************************************9987767************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlG 138 +sryf+vc+Nv+G+c GstgP+s+np+tgk +g +fP +ti D+v+aq++l+d+Lg+++l+avvGgS+G lcl|NCBI__GCF_000015165.1:WP_041750362.1 106 PSRYFIVCSNVIGGCMGSTGPASLNPATGKVWGLDFPIITIPDMVRAQAMLIDHLGIDTLFAVVGGSMG 174 ********************************************************************* PP TIGR01392 139 GmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARm 206 Gmqal+w+++yp+rv +++++a ++r+saq+iaf+e+ rqa+++Dp++ +G+y +++ +P++GLa+ARm lcl|NCBI__GCF_000015165.1:WP_041750362.1 175 GMQALQWTVAYPQRVFATLAIACATRHSAQNIAFHELGRQAVMADPDWDHGRYGDKGvHPHRGLAVARM 243 ********************************************************************* PP TIGR01392 207 lalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdla 275 a++tY+s+++l+++fgr+++++e +++s++++f+vesylryqg++fverFdAnsYl+lt+a+d++d+a lcl|NCBI__GCF_000015165.1:WP_041750362.1 244 AAHITYLSDAALHRKFGRRMQDRELPTFSFDADFQVESYLRYQGSSFVERFDANSYLYLTRAMDYFDIA 312 ********************************************************************* PP TIGR01392 276 rgrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 +++++ l++a++ ik++++vv+++sD+lf+++e++ l++al+a++++ +aeie+++GHDaFll+ ++ lcl|NCBI__GCF_000015165.1:WP_041750362.1 313 ADHDGVLAAAFRGIKTRFCVVSFTSDWLFPTSESRALVHALNASSARvsFAEIETDKGHDAFLLDVPEF 381 *******************************************999999*****************999 PP TIGR01392 343 eelirefl 350 ++ ++fl lcl|NCBI__GCF_000015165.1:WP_041750362.1 382 FDIASAFL 389 88877776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (404 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 8.31 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory