Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate WP_011779502.1 MVAN_RS11410 N-acetylglutaminylglutamine amidotransferase
Query= CharProtDB::CH_007942 (614 letters) >NCBI__GCF_000015305.1:WP_011779502.1 Length = 601 Score = 231 bits (588), Expect = 9e-65 Identities = 169/550 (30%), Positives = 259/550 (47%), Gaps = 40/550 (7%) Query: 1 MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDI-EGG 59 MCG TG V + + M + + RGPD + VW + V GH+RL ++D+ E G Sbjct: 1 MCGATGEVRLDGT-TPNVRAVTAMAEVMVPRGPDSAGVWSQGRVALGHRRLKIIDLSEAG 59 Query: 60 RQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVD 119 QPM G TI +NG +YN E LR EL G++F SDTEVLL Y W + VD Sbjct: 60 AQPMVDAELG--LTIAWNGCIYNYEQLRDELSGHGYRFFSHSDTEVLLKGYHHWGDRFVD 117 Query: 120 HLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDR 179 HL G+FAFA+ + + RDRLG+KP + T+ F S + A+LA ++ R+D Sbjct: 118 HLKGMFAFAIVERDSGRVLLGRDRLGIKPLYLTRTADRVRFASSLPALLAGGEVDTRIDP 177 Query: 180 TGLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDG-LNIWRYWNVESEKHTD----S 234 L I +G++++ PA DG + YW + + + S Sbjct: 178 VALHHYMTFHSVVPAPRTILRGVEKLPPASLTAIEPDGRITTTTYWEPDFSRREERAGWS 237 Query: 235 FDDTVANVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSI 294 D V + AV R+LV+DVPV LSGG+DSS I + A + G+ L T+SI Sbjct: 238 EKDWEDAVLESLRVAVKRRLVADVPVGCLLSGGVDSSLIVGLLA----EAGQHGLATFSI 293 Query: 295 DYEENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGM 354 F++ D+ + + + + FGT HH+ I + ++ L A+ P + Sbjct: 294 G-------FESVGGVAGDEFKYSDIIADRFGTDHHQIRIGTERMLPALGGAIGAMSEPMV 346 Query: 355 ADVDSSLLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRSTEERIKLLS 414 + + +E+ K V SG+ ADE+F GY W+ G P S E + Sbjct: 347 SHDCVAFYLLSQEVAKHVKVVQSGQGADEVFAGYHWY----PPMGEPAAASVEGSVASYR 402 Query: 415 DSW--QKKLNLKEYVNAKYEETLAETPLL--------DGETGVDKARRQLFYLNMLWFMT 464 ++ + + + V+ Y + L +TGVD+A R + + Sbjct: 403 AAFFDRDRDGYADIVSPGYLAADDPSELFVTEHFARPGAQTGVDRALR---LDTTVMLVD 459 Query: 465 NLLDRKDRMSMGASLEVRVPFADHRLVEYVWNIPWEMK-MHDNREKGILRKALEGILPDD 523 + + R D M+M LE RVPF DH LVE P ++K HD KG+L++A ++P + Sbjct: 460 DPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPQLKTAHDG--KGVLKQAARQVIPSE 517 Query: 524 ILYRKKSPYP 533 ++ R K +P Sbjct: 518 VIDRPKGYFP 527 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 919 Number of extensions: 41 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 614 Length of database: 601 Length adjustment: 37 Effective length of query: 577 Effective length of database: 564 Effective search space: 325428 Effective search space used: 325428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate WP_011779502.1 MVAN_RS11410 (N-acetylglutaminylglutamine amidotransferase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.2249.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-131 423.9 0.0 6.8e-131 423.7 0.0 1.0 1 lcl|NCBI__GCF_000015305.1:WP_011779502.1 MVAN_RS11410 N-acetylglutaminylg Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_011779502.1 MVAN_RS11410 N-acetylglutaminylglutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.7 0.0 6.8e-131 6.8e-131 1 516 [. 2 525 .. 2 526 .. 0.89 Alignments for each domain: == domain 1 score: 423.7 bits; conditional E-value: 6.8e-131 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsne 68 Cg +g v l+ ++ + +a+ +m+e++ RGPD+ gvw++ +++lghrRL iidlse+ aQP+ ++ lcl|NCBI__GCF_000015305.1:WP_011779502.1 2 CGATGEVRLDGTTP-NVRAVTAMAEVMVPRGPDSAGVWSQ---GRVALGHRRLKIIDLSEAgAQPMVDA 66 88899999877654.4689********************9...8***************999******* PP TIGR01536 69 k.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgel 136 + +i +nG IYN+e+Lr+el +Gy+F ++sDtEV+L+ y++wg ++v++L+GmFAfa++++ +g++ lcl|NCBI__GCF_000015305.1:WP_011779502.1 67 ElGLTIAWNGCIYNYEQLRDELSGHGYRFFSHSDTEVLLKGYHHWGDRFVDHLKGMFAFAIVERDSGRV 135 **99***************************************************************** PP TIGR01536 137 flaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlq.lvptektlfkevkele 204 +l RDrlGikPLY +++++++ faS + alla e+++++d al++++t++ +vp ++t+ ++v++l+ lcl|NCBI__GCF_000015305.1:WP_011779502.1 136 LLGRDRLGIKPLYLTRTADRVRFASSLPALLAGGEVDTRIDPVALHHYMTFHsVVPAPRTILRGVEKLP 204 ****************************************************999************** PP TIGR01536 205 pakal....dgeekleeywevekee....vkeseeelveelrelledavkkrlvadvpvgvllSGGlDS 265 pa+ dg + +ywe + ++ se++ + + e l+ avk+rlvadvpvg+llSGG+DS lcl|NCBI__GCF_000015305.1:WP_011779502.1 205 PASLTaiepDGRITTTTYWEPDFSRreerAGWSEKDWEDAVLESLRVAVKRRLVADVPVGCLLSGGVDS 273 ***99996666666666***988876666667899999******************************* PP TIGR01536 266 slvaaiakkeaksevktFsigfe..dskdldeskaarkvadelgtehkevliseeevlkeleevilale 332 sl++ ++++ ++ + tFsigfe + + de k+ +ad +gt+h+++ i e +l +l i a+ lcl|NCBI__GCF_000015305.1:WP_011779502.1 274 SLIVGLLAEAGQHGLATFSIGFEsvGGVAGDEFKYSDIIADRFGTDHHQIRIGTERMLPALGGAIGAMS 342 ************9**********65566668888*********************************** PP TIGR01536 333 eptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeealelpease.laekklllqa 400 ep+ ++++ ylls+++ ++ vkVv sG+GaDE+f+GY+++ + +a+ + + +++ + ++ lcl|NCBI__GCF_000015305.1:WP_011779502.1 343 EPMVSHDCVAFYLLSQEVAKH-VKVVQSGQGADEVFAGYHWYPPMGEPAAASVEGSVAsYRAAFFDRDR 410 *********************.********************998777777643333324444445555 PP TIGR01536 401 klakeselkellkakleeelkekeelkkelkeeseleellrldlelllsdl.lrakDrvsmahslEvRv 468 + ++ +l a+ ++el +e ++++ +++ ++++lrld++ +l d+ +++ D ++ma++lE Rv lcl|NCBI__GCF_000015305.1:WP_011779502.1 411 DGYADIVSPGYLAADDPSELFVTE-HFARPGAQTGVDRALRLDTTVMLVDDpVKRVDNMTMAWGLEGRV 478 666666666777766666665554.4555666688888999988887776526777************* PP TIGR01536 469 PflDkelvelalsippelklrdgkeKvlLreaaeellPeeileRkKea 516 PflD+elvela++ pp+lk+ ++ K +L++aa++++P+e+ +R+K lcl|NCBI__GCF_000015305.1:WP_011779502.1 479 PFLDHELVELAATCPPQLKTA-HDGKGVLKQAARQVIPSEVIDRPKGY 525 *******************85.789********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (601 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 9.71 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory