Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_011781501.1 MVAN_RS21815 homoserine kinase
Query= BRENDA::P07128 (309 letters) >NCBI__GCF_000015305.1:WP_011781501.1 Length = 314 Score = 291 bits (746), Expect = 1e-83 Identities = 160/303 (52%), Positives = 198/303 (65%), Gaps = 8/303 (2%) Query: 1 MAIELNVGRKVTVTVPGSSANLGPGFDTLGLALSVYDTVEVEIIPSGLEVEVFGEGQGEV 60 M L G T V SSANLGPGFD++GLA+ +YD + VE SGL VEV GEG G+V Sbjct: 1 MTRTLPPGLTATAVVAASSANLGPGFDSMGLAIGLYDEIVVETTESGLVVEVEGEGSGQV 60 Query: 61 PLDGSHLVVKAIRAGLKAADAEVPGLRVVCHNNIPQSRGLGSSAAAAVAGVAAANGLA-- 118 PLDGSHLVV+AI GL+ PGL V C N+IP SRGLGSSAAA V G+AAANGLA Sbjct: 61 PLDGSHLVVRAIERGLRETGVSAPGLIVRCRNDIPHSRGLGSSAAAVVGGLAAANGLAAQ 120 Query: 119 --DFPLTQEQIVQLSSAFEGHPDNAAASVLGGAVVSWTNLSIDGKSQPQYAAVPLEVQDN 176 ++ E++VQ+SS FEGHPDNAAA+VLGGAVV+WT G P+YAA P+ + + Sbjct: 121 TDSTLMSPERLVQVSSEFEGHPDNAAAAVLGGAVVAWT---AAGAGDPRYAAAPIRLHPD 177 Query: 177 IRATALVPNFHASTEAVRRVLPTEVTHIDARFNVSRVAVMIVALQQRPDLLWEGTRDRLH 236 I A VP +ST R +LP V H DARFN+SR A+++VAL +RPDLL E T D LH Sbjct: 178 IAIFAAVPQVRSSTAETRVLLPEHVRHTDARFNLSRAALLVVALTERPDLLMEATEDVLH 237 Query: 237 QPYRAEVLPITSEWVNRLRNRGYAAYLSGAGPTAMVLSTE-PIPDKVLEDARESGIKVLE 295 QP RA +P ++E++ LR G A LSGAGP + LSTE +P + L + G V Sbjct: 238 QPQRAAAMPASAEYLAMLRRCGVPAVLSGAGPAVLALSTETELPAEALRYGADHGFAVKR 297 Query: 296 LEV 298 + V Sbjct: 298 MSV 300 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 314 Length adjustment: 27 Effective length of query: 282 Effective length of database: 287 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_011781501.1 MVAN_RS21815 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.24285.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-62 197.3 0.1 1.6e-62 197.0 0.1 1.0 1 lcl|NCBI__GCF_000015305.1:WP_011781501.1 MVAN_RS21815 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_011781501.1 MVAN_RS21815 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 197.0 0.1 1.6e-62 1.6e-62 5 270 .. 15 281 .. 12 312 .. 0.91 Alignments for each domain: == domain 1 score: 197.0 bits; conditional E-value: 1.6e-62 TIGR00191 5 vPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakkvlkk 73 v assANlgpGfD++Gla+ l++e++v+ +es +e egeg ++p++ l+ +++++ l++ lcl|NCBI__GCF_000015305.1:WP_011781501.1 15 VAASSANLGPGFDSMGLAIGLYDEIVVET---TESGLV-VEVEGEGSGQVPLD-GSHLVVRAIERGLRE 78 789**********************9999...666666.999999999*****.899************ PP TIGR00191 74 lgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglk....lskeelldlalllEgHpDNvap 138 +g + +++ ++ +++ip +rGLGSSaaa+v++++aan la + +s e+l+++ ++ EgHpDN+a+ lcl|NCBI__GCF_000015305.1:WP_011781501.1 79 TGVSAPGLIVRCRNDIPHSRGLGSSAAAVVGGLAAANGLAAQTdstlMSPERLVQVSSEFEGHPDNAAA 147 *************************************98765423337889****************** PP TIGR00191 139 allGGlqlavkedd....llevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlav 203 a+lGG ++a + + ++ ++++ + +++P++ sTae+R +LP++++ d+ fnls++a+ lcl|NCBI__GCF_000015305.1:WP_011781501.1 148 AVLGGAVVAWTAAGagdpRYAAAPIRLHPDIAIFAAVPQVRSSTAETRVLLPEHVRHTDARFNLSRAAL 216 *******9999888786766666666779**************************************** PP TIGR00191 204 lvtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.e 270 lv Al+++ +dll a +D++hqp R+ +P+ +e + + g+ +lSGaGp++lal++e++ + lcl|NCBI__GCF_000015305.1:WP_011781501.1 217 LVVALTER--PDLLMEATEDVLHQPQRAAAMPASAEYLAMLRRCGV-PAVLSGAGPAVLALSTETElP 281 ******99..9***************************99999986.568*************99853 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory