Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_011781668.1 MVAN_RS22685 aminotransferase IV
Query= curated2:O29329 (290 letters) >NCBI__GCF_000015305.1:WP_011781668.1 Length = 337 Score = 157 bits (396), Expect = 4e-43 Identities = 94/292 (32%), Positives = 154/292 (52%), Gaps = 11/292 (3%) Query: 5 YMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNGRVFRLKEHIDRLYDSAKAIDLEIP 64 +++GE++P +AK+SIFD GF + D + ++G +FRL +H+DRL D A+ + L+ Sbjct: 47 WIEGEYLPAEDAKISIFDTGFGHSDLTYTVAHVWHGNIFRLGDHLDRLLDGARKLRLDSG 106 Query: 65 ITKEEFMEIILETLRKNNLRDAYIRPIVTRGIG------DLGLDPRKCQNPSIIVITKPW 118 TK+E +I + + + LR++++ +TRG G DL + I I W Sbjct: 107 YTKDELADITKKCVSLSQLRESFVNLTITRGYGKRKGEKDLS---KLTHQVYIYAIPYLW 163 Query: 119 GKLYGDLYEKGLTAITVAVRRNSFDALPPNIKSLNYLNNILAKIEANAKGGDEAIFLDRN 178 + + VRR + + P IK+ + + A EA +G AI +D + Sbjct: 164 AFPPAEQIFGTTAVVPRHVRRAGRNTVDPTIKNYQWGDLTAASFEAKDRGARTAILMDAD 223 Query: 179 GYVSEGSGDNIFVVKNGAITTPPTINNLRGITREAVIEIINRLGIPFKETNIGLYDLYTA 238 V+EG G N+ +VK+G + + P+ N L GITR+ V EI +GI ++ ++LY A Sbjct: 224 NCVAEGPGFNVCIVKDGKLAS-PSRNALPGITRKTVFEIAGAMGIEAALRDVTSHELYDA 282 Query: 239 DEVFVTGTAAEIAPIVVIDGRKIGDGKPGEITRKLMEEFSKLTESEGVPIYE 290 DE+ TA + PI +DG IGDG+PG +T + + F L + G P+ E Sbjct: 283 DEIMAVTTAGGVTPINTLDGVPIGDGEPGPVTVAIRDRFWALMDEPG-PLIE 333 Lambda K H 0.319 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 337 Length adjustment: 27 Effective length of query: 263 Effective length of database: 310 Effective search space: 81530 Effective search space used: 81530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory