Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_011802171.1 PNAP_RS13945 phosphoserine aminotransferase
Query= BRENDA::Q96255 (430 letters) >NCBI__GCF_000015505.1:WP_011802171.1 Length = 368 Score = 367 bits (943), Expect = e-106 Identities = 186/368 (50%), Positives = 253/368 (68%), Gaps = 11/368 (2%) Query: 72 RVFNFAAGPATLPENVLLKAQADLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLE 131 R FNF+AGPA LPE VL +A A++ +W GSGMSVMEMSHRGKEF+SI + AE+D R+L+E Sbjct: 3 RPFNFSAGPANLPEEVLRQAAAEMLDWHGSGMSVMEMSHRGKEFISIYEHAEADFRELME 62 Query: 132 IPQEYSVLFLQGGATTQFAALPLNLCKSDDTVDFVVTGSWGDKAVKEAKKYCKTNVIWSG 191 IP+ + +LF+QGG + A +PLN+ + DFVVTGSW DK+ KEA+KYC + + Sbjct: 63 IPEHFKILFMQGGGLAENAIVPLNISRG-GLADFVVTGSWSDKSQKEARKYCDVQIAATN 121 Query: 192 KSEKYTKVPSFEELEQTPDAKYLHICANETIHGVEFKDYP----VPKNGFLVADMSSNFC 247 +S +T +P + DA Y+H+C NETIHGVEF++ P + + LV D SS+ Sbjct: 122 ESSAHTSLPPPATWQLRRDASYVHVCTNETIHGVEFQELPDLKALGSDAPLVIDFSSHVA 181 Query: 248 SKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIHDENSSLYNT 307 S+PVD SK G+ +GGAQKN+GP+GVT+V++R+DL+G+A + P +YK +N S+YNT Sbjct: 182 SRPVDWSKVGLAFGGAQKNLGPAGVTLVVVREDLLGHALAVCPSAFNYKTVADNDSMYNT 241 Query: 308 PPCFGIYMCGLVFEDLLEQ-----GGLKEVEKKNQRKADLLYNAIEESNGFFRCPVEKSV 362 PP + IY+ GL F+ L Q G+ +EK N KA LLY+AI+ S G + V K Sbjct: 242 PPTYAIYIAGLTFQWLKRQKEGEATGIAAMEKHNLAKAKLLYDAIDHS-GLYINKVSKDC 300 Query: 363 RSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFM 422 RS MNVPF L +F+ A ++QLKGH+SVGGMRASIYNAMPLAGVE LV+++ Sbjct: 301 RSRMNVPFLLRDESRNEDFLAGAKARGLLQLKGHKSVGGMRASIYNAMPLAGVEALVSYL 360 Query: 423 KDFQAKHA 430 ++F+ KHA Sbjct: 361 QEFEQKHA 368 Lambda K H 0.316 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 368 Length adjustment: 31 Effective length of query: 399 Effective length of database: 337 Effective search space: 134463 Effective search space used: 134463 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011802171.1 PNAP_RS13945 (phosphoserine aminotransferase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.10242.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-149 482.6 0.0 3.6e-149 482.4 0.0 1.0 1 lcl|NCBI__GCF_000015505.1:WP_011802171.1 PNAP_RS13945 phosphoserine amino Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011802171.1 PNAP_RS13945 phosphoserine aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 482.4 0.0 3.6e-149 3.6e-149 2 358 .] 5 367 .. 4 367 .. 0.97 Alignments for each domain: == domain 1 score: 482.4 bits; conditional E-value: 3.6e-149 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflq 70 +nFsaGPa lpeevl++a++e+ld++g+g+svme+sHR kef ++ e+ae d+reL++ip+++++lf+q lcl|NCBI__GCF_000015505.1:WP_011802171.1 5 FNFSAGPANLPEEVLRQAAAEMLDWHGSGMSVMEMSHRGKEFISIYEHAEADFRELMEIPEHFKILFMQ 73 8******************************************************************** PP TIGR01364 71 GGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelked 139 GG+ + a vpln+ + + ad++vtG+ws+k+ kea+k+++ v+++a++e++ ++++p +++l+ d lcl|NCBI__GCF_000015505.1:WP_011802171.1 74 GGGLAENAIVPLNISRGG-LADFVVTGSWSDKSQKEARKYCD-VQIAATNESSAHTSLPPPATWQLRRD 140 **************9988.9*********************9.************************** PP TIGR01364 140 aayvylcanetieGvefkelpevkk....aplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvv 204 a+yv++c+neti+Gvef+elp+ k aplv D+ss++ sr++d sk gl ++GaqKn+GpaGvt+v lcl|NCBI__GCF_000015505.1:WP_011802171.1 141 ASYVHVCTNETIHGVEFQELPDLKAlgsdAPLVIDFSSHVASRPVDWSKVGLAFGGAQKNLGPAGVTLV 209 **********************99888889*************************************** PP TIGR01364 205 ivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkek..G...GvkklekknqeK 268 +vr+dll++a +++ps ++Yk++a+nds+yntppt+aiy++gl+++wlk++ G G++++ek+n +K lcl|NCBI__GCF_000015505.1:WP_011802171.1 210 VVREDLLGHALAVCPSAFNYKTVADNDSMYNTPPTYAIYIAGLTFQWLKRQkeGeatGIAAMEKHNLAK 278 ************************************************965343444************ PP TIGR01364 269 akllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYn 337 akllY+aid+s g+y+nkv+k++Rs+mnv+F l++e ++ Fl+ a+++gl++lkGh+svGG+RasiYn lcl|NCBI__GCF_000015505.1:WP_011802171.1 279 AKLLYDAIDHS-GLYINKVSKDCRSRMNVPFLLRDESRNEDFLAGAKARGLLQLKGHKSVGGMRASIYN 346 *********88.7******************************************************** PP TIGR01364 338 alpleevqaLvdfmkeFekkh 358 a+pl++v+aLv++++eFe+kh lcl|NCBI__GCF_000015505.1:WP_011802171.1 347 AMPLAGVEALVSYLQEFEQKH 367 *******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory