Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate WP_011841953.1 RSPH17029_RS14595 shikimate dehydrogenase
Query= reanno::Caulo:CCNA_00003 (285 letters) >NCBI__GCF_000015985.1:WP_011841953.1 Length = 279 Score = 200 bits (508), Expect = 3e-56 Identities = 118/270 (43%), Positives = 147/270 (54%), Gaps = 2/270 (0%) Query: 11 VGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFAPA-ADRFETFVDGLRGGAVRGLNVT 69 + GV G PI HS SP +H W+ GL Y+P A AD + R G V G NVT Sbjct: 9 LAGVIGSPIAHSRSPALHGYWLKRYGLKGHYIPMDVAQADLRDVLAAMPRMGFV-GCNVT 67 Query: 70 IPFKERALAVADTASDLARMAGAANLLVFNEDGSVHADNTDGPGLLGAIAIQAPGFDVTA 129 IP KE + +AD +D A + GAAN L+F +DG ++ADNTDG G + AP + + Sbjct: 68 IPHKESVIGLADIVTDRAALIGAANTLIFRKDGKIYADNTDGTGFTANLRQNAPAWQPQS 127 Query: 130 APVVILGAGGAARGAVAALLLAGAPRIAVVNRTVARAQDLADTFGEKVVAKGEDALPALL 189 P V+ GAGGAAR +AAL+ G P I + NR+ ARA L FG KV +L Sbjct: 128 GPAVVWGAGGAARAVIAALIEVGVPEIRLANRSRARADALRSDFGAKVHVHDWVQAGNIL 187 Query: 190 PEAGLIINATSLGLGGGAGPSADLTLTPKTAVVMDMVYKPLRTEFLRRAEAAGRRTVDGL 249 +A ++N TSLG+ G L AVV D+VY PLRT L AEAAG RTVDGL Sbjct: 188 EDAMTVVNTTSLGMVGKPEFRVPLDALNPKAVVTDLVYAPLRTRLLVEAEAAGCRTVDGL 247 Query: 250 EMLLRQAIPTFETIYGQAPSPKIDVRVLAL 279 MLL QA P FE +G P + R L Sbjct: 248 GMLLHQAAPGFERWFGVRPEVDEETRAAVL 277 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 279 Length adjustment: 26 Effective length of query: 259 Effective length of database: 253 Effective search space: 65527 Effective search space used: 65527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_011841953.1 RSPH17029_RS14595 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.19245.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-71 225.7 0.0 3.6e-71 225.5 0.0 1.0 1 lcl|NCBI__GCF_000015985.1:WP_011841953.1 RSPH17029_RS14595 shikimate dehy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015985.1:WP_011841953.1 RSPH17029_RS14595 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.5 0.0 3.6e-71 3.6e-71 2 261 .. 9 271 .. 8 278 .. 0.94 Alignments for each domain: == domain 1 score: 225.5 bits; conditional E-value: 3.6e-71 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 l gviG pi+hS sp++h lk gl+++Y+ ++v + +l+++l ++ g+ G+nvT+P+Ke+v+ l lcl|NCBI__GCF_000015985.1:WP_011841953.1 9 LAGVIGSPIAHSRSPALHGYWLKRYGLKGHYIPMDVAQADLRDVLAAMPRMGFVGCNVTIPHKESVIGL 77 679****************************************************************** PP TIGR00507 71 lDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklks.ekrvliiGAGGaakavaleL 136 +D ++++a+liga NTl ++dgk++++nTDg G++++L++ ++ +++ GAGGaa+av+ +L lcl|NCBI__GCF_000015985.1:WP_011841953.1 78 ADIVTDRAALIGAANTLIfRKDGKIYADNTDGTGFTANLRQnAPAWQPqSGPAVVWGAGGAARAVIAAL 146 *****************9999********************64434431456999************** PP TIGR00507 137 lka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaell 204 + e+ +aNR+ ++a +l + + + ++ + ++ l+ ++n+ts+g+ g+ e v+ + l lcl|NCBI__GCF_000015985.1:WP_011841953.1 147 IEVgVPEIRLANRSRARADALRSDFGAKVHVHDWVQAGNILEDAMTVVNTTSLGMVGKP-EFRVPLDAL 214 ***5579*******************999999999999999999999*********987.********* PP TIGR00507 205 kegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekv 261 + +++v Dlvy+pl t ll ea+ g++++dGlgMl +Qaa Fe w+gv p+v++ lcl|NCBI__GCF_000015985.1:WP_011841953.1 215 NPKAVVTDLVYAPLRTRLLVEAEAAGCRTVDGLGMLLHQAAPGFERWFGVRPEVDEE 271 ****************************************************99764 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (279 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory