Align 3-phosphoglycerate dehydrogenase (characterized, see rationale)
to candidate WP_011842048.1 RSPH17029_RS15380 hydroxyacid dehydrogenase
Query= uniprot:A0A1X9ZCD3 (315 letters) >NCBI__GCF_000015985.1:WP_011842048.1 Length = 316 Score = 127 bits (318), Expect = 5e-34 Identities = 81/254 (31%), Positives = 129/254 (50%), Gaps = 20/254 (7%) Query: 52 VRKELIDAVPNIKLIGRGGVGMDNIDVEYARSQGINVVNTPAASSLSVAELVFSHLFTGI 111 V E++ P +K + + GVG+DNID+ + G+ V NTPAA++ +VAEL +F Sbjct: 54 VMAEVLAKGPRLKGVLKHGVGVDNIDIPACTAAGLPVTNTPAANADAVAELAMGLMFAMA 113 Query: 112 RFLQDANRKMPVEGSTQFNNLKKAYAKGTELSGKTIGIIGFGRIGRATAKVALGLGMNVL 171 RF+ + + G + GT+L GK +GI+G G IG+ A++A GLGM VL Sbjct: 114 RFIPQGHASVTSGGWDR--------RIGTQLGGKVLGIVGLGNIGKRLARLARGLGMEVL 165 Query: 172 AYDLYPSESEITLEFQGGKSVSIPIKTVSLDEVITGSDFFSLHT--PFADKPILGAEEFA 229 A D + + + L+E++ +D+ SLH + ++ A Sbjct: 166 ATDRVE---------DAAFARDCGVTYLPLEELLARADYVSLHVFGGSGNAALIDDRALA 216 Query: 230 KMKNGVGIVNCSRGGTIDELALIDALNSGKVSFAGLDVFDNEPTPLAE-ILTHPKISLTP 288 ++K G +VN +RG +D A+ AL SG++ +D + EP ++ + HP TP Sbjct: 217 RLKPGARLVNLARGEVVDLDAVGRALESGQLGGVAIDAYVTEPPDVSHPVFAHPNAVFTP 276 Query: 289 HIGASTNEAQERIG 302 H GA T EA E +G Sbjct: 277 HSGADTLEALENVG 290 Lambda K H 0.316 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 316 Length adjustment: 27 Effective length of query: 288 Effective length of database: 289 Effective search space: 83232 Effective search space used: 83232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory