Align branched-chain-amino-acid aminotransferase subunit (EC 2.6.1.42) (characterized)
to candidate WP_002721560.1 RSPH17029_RS14130 branched-chain amino acid aminotransferase
Query= metacyc::MONOMER-11914 (306 letters) >NCBI__GCF_000015985.1:WP_002721560.1 Length = 288 Score = 229 bits (584), Expect = 6e-65 Identities = 122/294 (41%), Positives = 181/294 (61%), Gaps = 14/294 (4%) Query: 4 EASGKIWLNGEMVEWEEATVHVLSHVVHYGSSVFEGIRCYRNSKGSAIFRLREHVKRLFD 63 + GKIW++G++VEW EA VH+L+H +HY SSVFEG RCY IF+ EH +RL Sbjct: 6 DRDGKIWMDGKLVEWREAKVHILTHALHYASSVFEGERCYNGK----IFKSVEHSERLRR 61 Query: 64 SAKIYRMDIPYTQEQICDAIVETVRENGLEECYIRPVVFRGYGE-MGVHPVNCPVDVAVA 122 S ++ M +PYT E+I A T+ NGL + Y+R + +RG GE MGV P+ VAVA Sbjct: 62 SGELLDMPLPYTVEEIEAAKKATLEANGLTDAYVRALAWRGAGEDMGVASSRNPIRVAVA 121 Query: 123 AWEWGAYLGAEALEVGVDAGVSTWRRMAPNTMPNMAKAGGNYLNSQLAKMEAVRHGYDEA 182 W WG Y G +A G +S W+R +P T+P+ AKA G Y+ ++K A G +A Sbjct: 122 VWSWGNYYG-DAKFKGAKLDISKWKRPSPETIPSAAKASGLYMICTMSKHAAEAKGCSDA 180 Query: 183 IMLDYHGYISEGSGENIFLVSEGEIYTPPVSSSLLRGITRDSVIKIARTEGVTVHEEPIT 242 +M DY GY++E +G NIF V +GE++T P+ ++L GITR +VI + R +G+ VHE I Sbjct: 181 MMFDYRGYVAEATGANIFFVKDGEVHT-PLPDAILNGITRQTVIGMLRDKGIKVHERYIE 239 Query: 243 REMLYIADEAFFTGTAAEITPIRSVD--GIEIGAGRRGPVTKLLQDEFFRIIRA 294 L ++ + TGTAAE+TP+ + E+GA +T+ + ++ +++RA Sbjct: 240 ASELEGFEQCWLTGTAAEVTPVGRIGDYSFEVGA-----LTREIATDYEKLVRA 288 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 288 Length adjustment: 26 Effective length of query: 280 Effective length of database: 262 Effective search space: 73360 Effective search space used: 73360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_002721560.1 RSPH17029_RS14130 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.23450.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-87 278.6 0.0 3.2e-87 278.4 0.0 1.0 1 lcl|NCBI__GCF_000015985.1:WP_002721560.1 RSPH17029_RS14130 branched-chain Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015985.1:WP_002721560.1 RSPH17029_RS14130 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 278.4 0.0 3.2e-87 3.2e-87 1 285 [. 12 287 .. 12 288 .] 0.97 Alignments for each domain: == domain 1 score: 278.4 bits; conditional E-value: 3.2e-87 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskee 69 w+dG+lv++++akvh+lthalhY ++vfeG R+Y++ if+ eh eRl s + l++++py+ ee lcl|NCBI__GCF_000015985.1:WP_002721560.1 12 WMDGKLVEWREAKVHILTHALHYASSVFEGERCYNG----KIFKSVEHSERLRRSGELLDMPLPYTVEE 76 9***********************************....9**************************** PP TIGR01122 70 lvevtkevlrknnlksaYiRplvyvGa.edlglkpkvdlkveviiaawewgaylgeealekGikvkvss 137 + + k +l +n+l++aY+R l+++Ga ed+g+ + +++v++a+w+wg+y+g+ a kG k +s lcl|NCBI__GCF_000015985.1:WP_002721560.1 77 IEAAKKATLEANGLTDAYVRALAWRGAgEDMGVAS-SRNPIRVAVAVWSWGNYYGD-AKFKGAKLDISK 143 **************************8458*****.777****************7.889********* PP TIGR01122 138 frraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvse 206 ++r ++++ip++aka+g Y+ ++ k+ a ++G +a++ d Gyvae +G nif vkdg++ tP + lcl|NCBI__GCF_000015985.1:WP_002721560.1 144 WKRPSPETIPSAAKASGLYMICTMSKHAAEAKGCSDAMMFDYRGYVAEATGANIFFVKDGEVHTPLP-D 211 *****************************************************************99.9 PP TIGR01122 207 siLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkk 275 +iL+gitr++vi +++++gi+v+e+ i +el + +ltGtaaevtP+ ++ + + ++G +t++ lcl|NCBI__GCF_000015985.1:WP_002721560.1 212 AILNGITRQTVIGMLRDKGIKVHERYIEASELEGFEQCWLTGTAAEVTPVGRIGDYSF---EVGALTRE 277 9****************************************************99876...7899**** PP TIGR01122 276 lqeaffdlve 285 + + + +lv+ lcl|NCBI__GCF_000015985.1:WP_002721560.1 278 IATDYEKLVR 287 *****99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (288 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.50 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory