Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_011841935.1 RSPH17029_RS14500 aminotransferase class IV
Query= curated2:O29329 (290 letters) >NCBI__GCF_000015985.1:WP_011841935.1 Length = 299 Score = 170 bits (431), Expect = 3e-47 Identities = 105/276 (38%), Positives = 154/276 (55%), Gaps = 13/276 (4%) Query: 4 VYMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNGRVFRLKEHIDRLYDSAKAIDLEI 63 ++++G +P EA VS++D GF+ GDGV+EGIR Y+GR L EH+DRL+++A AIDL+I Sbjct: 21 LWLNGRILPRAEALVSVYDSGFMLGDGVWEGIRLYDGRWAFLDEHLDRLFEAALAIDLDI 80 Query: 64 PITKEEFMEIILETLRKNNLR-DAYIRPIVTRGIGDLGLDPRKC--QNPSIIVI---TKP 117 + + + IL+T N + DA+ R +VTRG+ Q P++ +I +KP Sbjct: 81 GMDRAALRQAILDTAAANGMATDAHARLMVTRGVKTRPFQHPSLSRQGPTVAIIMEHSKP 140 Query: 118 WGKLYGDLYEKGLTAITVAVRRNSFDALPPNIKSLNYLNNILAKIEANAKGGDEAIFLDR 177 + + TV R + P + S + LN ILA I A G DEA+ LD Sbjct: 141 -------KIPRPIRLATVPHIRGLPMSQDPKLNSHSKLNCILACIAAEKAGADEALMLDV 193 Query: 178 NGYVSEGSGDNIFVVKNGAITTPPTINNLRGITREAVIEIINRLGIPFKETNIGLYDLYT 237 +G+V+ + N F+V+ G + T + GITR VI I GIP E N L + Y+ Sbjct: 194 HGFVNTTNACNFFIVRKGEVWTSTGDYCMNGITRGKVIRICREAGIPVFEKNFSLVETYS 253 Query: 238 ADEVFVTGTAAEIAPIVVIDGRKIGDGKPGEITRKL 273 ADE F+TGT P+ IDGR+IG G+ G +T +L Sbjct: 254 ADEAFLTGTFGAQTPVGSIDGRRIGTGEMGPMTERL 289 Lambda K H 0.319 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 299 Length adjustment: 26 Effective length of query: 264 Effective length of database: 273 Effective search space: 72072 Effective search space used: 72072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory