Align Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 (characterized)
to candidate WP_048058462.1 MMARC5_RS04495 fructose-bisphosphate aldolase
Query= SwissProt::P58315 (263 letters) >NCBI__GCF_000016125.1:WP_048058462.1 Length = 272 Score = 159 bits (402), Expect = 6e-44 Identities = 88/256 (34%), Positives = 144/256 (56%), Gaps = 10/256 (3%) Query: 10 RIFARRG-KSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAE-- 66 RIF ++ K++I+ DHG+ GP D + D D G + V+ +G+ Sbjct: 18 RIFDKKSEKTVIIPMDHGVSSGPLDGIK-----DMRITTNAVADGGANAVLGHKGLVRHG 72 Query: 67 -KYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFE 125 + Y + LI+ ++ T++ V +VE+A+ LGA AV + G+ +++M+ Sbjct: 73 HRGYGRDIGLIIHMSAGTSISPDPNKKVIVTTVEDAIRLGADAVSLHVNVGAESDFEMYR 132 Query: 126 ELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPK 185 +L I ++ +PL+ YPRG K+ +E PE+VA+AAR+ ELGAD +K YTGDP Sbjct: 133 DLGLISETCEQWGMPLIAMMYPRGPKIKDEKDPEVVAHAARLGAELGADIIKTNYTGDPD 192 Query: 186 TFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFAR 245 TF VK P++++GGPKT T+E+FL+ V+ + AG G+A GRNV+Q +D Sbjct: 193 TFKEVVK-GCPAPIVIAGGPKTNTDEEFLQMVKDAMHAGGKGVASGRNVFQHKDVKGITS 251 Query: 246 ALAELVYGGKKLAEPL 261 A+ ++V+ ++ E L Sbjct: 252 AICKIVHEDAEVKEAL 267 Lambda K H 0.318 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 272 Length adjustment: 25 Effective length of query: 238 Effective length of database: 247 Effective search space: 58786 Effective search space used: 58786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory