Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_011868822.1 MMARC5_RS05385 phosphoserine phosphatase SerB
Query= SwissProt::Q58989 (211 letters) >NCBI__GCF_000016125.1:WP_011868822.1 Length = 213 Score = 253 bits (646), Expect = 2e-72 Identities = 125/206 (60%), Positives = 164/206 (79%) Query: 5 KKLILFDFDSTLVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQSLRKRVSLLKDLP 64 KKLILFD DSTL + E IDEIA+ AGVE E+KKIT+EAM+GK+ FE+SL++RV LK +P Sbjct: 7 KKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITEEAMKGKIKFEESLKRRVKFLKGIP 66 Query: 65 IEKVEKAIKRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLI 124 +EK+++ K+I GA E I ELK +GYV AVVSGGFD +K+ LGLDY+++N L+ Sbjct: 67 VEKLDEFAKKIPIMNGAHELIGELKKQGYVTAVVSGGFDFGAEHVKKVLGLDYSYSNTLL 126 Query: 125 VKDGKLTGDVEGEVLKENAKGEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLKIAF 184 ++G LTG+V G V+ E AKG+IL++IA E I+LE+TV VGDGAND+SMF++AG KIAF Sbjct: 127 SENGILTGEVIGPVMGETAKGDILKEIAANENISLENTVVVGDGANDVSMFERAGFKIAF 186 Query: 185 CAKPILKEKADICIEKRDLREILKYI 210 CAK IL+ KADICI+K+DL+EIL Y+ Sbjct: 187 CAKEILRSKADICIDKKDLKEILNYL 212 Lambda K H 0.314 0.136 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 213 Length adjustment: 21 Effective length of query: 190 Effective length of database: 192 Effective search space: 36480 Effective search space used: 36480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_011868822.1 MMARC5_RS05385 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.5799.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-85 271.0 4.9 4e-85 270.9 4.9 1.0 1 lcl|NCBI__GCF_000016125.1:WP_011868822.1 MMARC5_RS05385 phosphoserine pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016125.1:WP_011868822.1 MMARC5_RS05385 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 270.9 4.9 4e-85 4e-85 11 219 .] 4 212 .. 1 212 [. 0.99 Alignments for each domain: == domain 1 score: 270.9 bits; conditional E-value: 4e-85 TIGR00338 11 lkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvellkk 79 ++ kkl++fDlDstl + EvIdeiak aGve e+++iTe+Am+g+++F+esl+ Rvk lkg+pve+l++ lcl|NCBI__GCF_000016125.1:WP_011868822.1 4 NSVKKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITEEAMKGKIKFEESLKRRVKFLKGIPVEKLDE 72 6789***************************************************************** PP TIGR00338 80 veeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvegeiv 148 ++k+++++G++el+ +Lk++gy +av+SGgFd+ ae++k+ Lgld+ +N+L e+g ltG+v g+++ lcl|NCBI__GCF_000016125.1:WP_011868822.1 73 FAKKIPIMNGAHELIGELKKQGYVTAVVSGGFDFGAEHVKKVLGLDYSYSNTLLSENGILTGEVIGPVM 141 ********************************************************************* PP TIGR00338 149 desakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdile 217 e ak+++l++++ +e+isle+tv+vGDGanD+sm+++Ag++iaf+ak++l++kadi+i+kkdl++il+ lcl|NCBI__GCF_000016125.1:WP_011868822.1 142 GETAKGDILKEIAANENISLENTVVVGDGANDVSMFERAGFKIAFCAKEILRSKADICIDKKDLKEILN 210 *******************************************************************98 PP TIGR00338 218 ll 219 +l lcl|NCBI__GCF_000016125.1:WP_011868822.1 211 YL 212 86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (213 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.10 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory