Align Homoserine dehydrogenase; HDH; EC 1.1.1.3 (uncharacterized)
to candidate WP_011869448.1 MMARC5_RS08730 homoserine dehydrogenase
Query= curated2:Q58997 (336 letters) >NCBI__GCF_000016125.1:WP_011869448.1 Length = 337 Score = 441 bits (1134), Expect = e-128 Identities = 228/336 (67%), Positives = 283/336 (84%), Gaps = 1/336 (0%) Query: 1 MDIIIVGFGAIGKGIAKVLYDKKDYLKKNYE-EFKVVAITDSSGAAIDEDGLDLLKAIEV 59 M II+VGFG IGKG+ K + K ++LKK Y + +V AI D SGAAIDE+GLDL A+++ Sbjct: 1 MKIILVGFGIIGKGVLKTITLKSEHLKKRYGMDLQVAAICDRSGAAIDENGLDLELALKI 60 Query: 60 KEKTGKIKNYPEKGREMSSIDVIKEVDADVVVEVTPSNLETGDPAKTHILESFKNKKHVV 119 KE+TGKI NYPEKG EM ++VI+ V AD VVEV+P+N+ETG+PAK+++L++F+ KKHVV Sbjct: 61 KEETGKIANYPEKGCEMGILEVIESVSADAVVEVSPTNIETGEPAKSYMLKAFECKKHVV 120 Query: 120 TANKGPLALCYKELIEEAKKHGVIFRHEASVGGAMPIINLAKETLAGNEILSIRGILNGT 179 +ANKGPLA+ +K+L++ AK++ V FR+EASVGGAMPIINLAKETLAGN+I I+GILNGT Sbjct: 121 SANKGPLAVSFKDLVKCAKENKVCFRYEASVGGAMPIINLAKETLAGNDIKLIKGILNGT 180 Query: 180 TNYILTKMEKEGLDFETALKEAKELGIAETDPTQDIEGLDTAAKIVILANSIMGMNKTIK 239 TNYILTKMEKE LDF+T LKEA+ELGIAET+P QDI GLDTAAKIVILANSI G + TIK Sbjct: 181 TNYILTKMEKEQLDFDTVLKEAQELGIAETNPHQDISGLDTAAKIVILANSIFGRDVTIK 240 Query: 240 DVKVKGISRITPEALFLANKRGYTIKLIGQIKDGYLIVEPMLVPIDSPLNVKGTLNVAMF 299 DV ++GI+RITPEAL +ANK G+TIKLIG++ D L V P L+PIDSPLNVKG+LNVAM Sbjct: 241 DVNLEGITRITPEALAMANKSGHTIKLIGEVTDKKLEVCPKLIPIDSPLNVKGSLNVAMV 300 Query: 300 ETDLAKEVVVVGRGAGPIETASAILSDLIHIYNSTK 335 TDLA ++VVVG GAG IETASAILSDL++I+ + K Sbjct: 301 NTDLANDIVVVGAGAGDIETASAILSDLVNIHQTLK 336 Lambda K H 0.314 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 337 Length adjustment: 28 Effective length of query: 308 Effective length of database: 309 Effective search space: 95172 Effective search space used: 95172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory