Align threonine synthase; EC 4.2.3.1 (characterized)
to candidate WP_011869285.1 MMARC5_RS07825 threonine synthase
Query= CharProtDB::CH_107419 (405 letters) >NCBI__GCF_000016125.1:WP_011869285.1 Length = 403 Score = 509 bits (1311), Expect = e-149 Identities = 255/400 (63%), Positives = 318/400 (79%), Gaps = 5/400 (1%) Query: 5 KCIECGAEYSRDEVIYTCSKCDGLLDVIYDYSSIK--IDMEKLKTECPSVWKYAKLLPVE 62 KC CG EY D +IY C +C GLL++ YD+ SIK + E L+ VW+Y LPV+ Sbjct: 4 KCRVCGKEYEVDAIIYNC-ECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLPVK 62 Query: 63 --REPVTIQEGGTPLYKCDRLAEKIGIKKLYVKHEGMNPTGSFKDRGMTVGVTKALELGM 120 + V++ EGGTPLYKC+ LA+K+G+K+LYVK+EG NPTGSFKDRGMTVGVT+A ELG+ Sbjct: 63 DPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANELGV 122 Query: 121 NTVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA 180 V CASTGNTSA+LA Y A+AG +VLLP GKVALGK+AQA+ +GAKV+ I GNFD+A Sbjct: 123 EVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFDEA 182 Query: 181 LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLDFKVPDRIVLPVGNAGNITAIY 240 L +V+ L + K+YLLNS+NP+RLEGQKTIGFEI DQLDF+VPD ++LPVGNAGNI+AI+ Sbjct: 183 LVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISAIW 242 Query: 241 KGFREFKILGITDSLPKMTGIQAEGSCPIVKAIKSGAPAITPEENPETVATAIRIGNPVN 300 KGF+EFK G+ D+LPKMTGIQAEG+ PIVKAIK+G I P+ENPET+ATAIRIGNPVN Sbjct: 243 KGFKEFKETGMIDTLPKMTGIQAEGAQPIVKAIKAGLDKIIPDENPETIATAIRIGNPVN 302 Query: 301 ATKALSAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLRKLVDMGVIGR 360 A KAL AI+ SGG AESVTDEEI AAQK LA+ EGI VEPASA+S+AGL KL+DMG+I + Sbjct: 303 AAKALDAIKSSGGLAESVTDEEITAAQKLLAQTEGIFVEPASASSIAGLIKLIDMGLIDK 362 Query: 361 DETVVCITTGHLLKDPQTVIDVCEEPTVVDANIDAIREAI 400 D+ +VCITTG+ LKDP I PT ++ +++ +R+AI Sbjct: 363 DQKIVCITTGNGLKDPDAAIKASTMPTEIECDMEVLRKAI 402 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 618 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 403 Length adjustment: 31 Effective length of query: 374 Effective length of database: 372 Effective search space: 139128 Effective search space used: 139128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011869285.1 MMARC5_RS07825 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.902.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-120 387.4 0.0 3.5e-120 387.2 0.0 1.0 1 lcl|NCBI__GCF_000016125.1:WP_011869285.1 MMARC5_RS07825 threonine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016125.1:WP_011869285.1 MMARC5_RS07825 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 387.2 0.0 3.5e-120 3.5e-120 1 340 [] 52 379 .. 52 379 .. 0.99 Alignments for each domain: == domain 1 score: 387.2 bits; conditional E-value: 3.5e-120 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltka 68 v+ry +l+v+ +++v+l+eg t+l+++++la+++g+++lyvk+++++Pt++FKDrg ++v++t+a lcl|NCBI__GCF_000016125.1:WP_011869285.1 52 VWRYLDYLPVKdPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRG---MTVGVTRA 117 8**********99*********************************************...******** PP TIGR00260 69 lelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaq 137 +elg+e+v+cA++G+t+a++a a++++a+ k++vL+P gk++ +kl++a++++akv++i+G+FD+a+ lcl|NCBI__GCF_000016125.1:WP_011869285.1 118 NELGVEVVGCASTGNTSASLA-AYSARAGKKCIVLLPGGKVA--LGKLAQAMFYGAKVIQINGNFDEAL 183 *********************.********************..************************* PP TIGR00260 138 dlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekk 205 +vk+++ +++ ++lnsvN p+r+e+qkt+ fei++ql+ e pd v++pv+ +gn++ai+kGf+e+k lcl|NCBI__GCF_000016125.1:WP_011869285.1 184 VMVKNLALENKLYLLNSVN---PFRLEGQKTIGFEICDQLDFEVPDMVILPVGnAGNISAIWKGFKEFK 249 *******************...*********************************************** PP TIGR00260 206 elg....lpieklaiaaegaadivrrflksg.dlepkedkeTlstAmdignpsnveralelarrslgnl 269 e+g lp ++++i+aega++iv++ + + ++ p e++eT++tA++ignp+n+ +al+++++s+g + lcl|NCBI__GCF_000016125.1:WP_011869285.1 250 ETGmidtLP-KMTGIQAEGAQPIVKAIKAGLdKIIPDENPETIATAIRIGNPVNAAKALDAIKSSGGLA 317 *********.*****************888899************************************ PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkd 338 e++ +deei+ a+k+la++eg+++ep++a ++a+l+kl++ g +d++ +++v++ tgn+lkd lcl|NCBI__GCF_000016125.1:WP_011869285.1 318 ESV----TDEEITAAQKLLAQTEGIFVEPASASSIAGLIKLIDMG---LIDKD--QKIVCITTGNGLKD 377 ***....**************************************...*****..************** PP TIGR00260 339 pe 340 p+ lcl|NCBI__GCF_000016125.1:WP_011869285.1 378 PD 379 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (403 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.01 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory