Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012565752.1 RC1_RS02465 PLP-dependent transferase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000016185.1:WP_012565752.1 Length = 383 Score = 268 bits (684), Expect = 3e-76 Identities = 157/381 (41%), Positives = 220/381 (57%), Gaps = 18/381 (4%) Query: 19 TLAIHGGQSPDPSTGAVMPPIYATSTYAQ----SSPGEHQGFEYSRTHNPTRFAYERCVA 74 TL + DP+T V+P ++ +T+ + S PG H Y+R NPT E +A Sbjct: 10 TLLARAQGAHDPATHGVVPAVHPATTFLRAGDLSYPGGHS---YARPFNPTFDGAETLLA 66 Query: 75 ALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFV 134 LEG +A F+SGM+A + V + L+ G HV+A +Y G R + + GL V Sbjct: 67 TLEGAAQALLFSSGMSAATAVFQALEPGDHVIAPQVMYWG-LRNWLKGFAAQWGLGLDLV 125 Query: 135 DLTDPAAFKAAIRAD-TKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPML 193 D+ DPAA AA+R T+++W ETP NP ++ D+AA A IA + G VDNT +P+L Sbjct: 126 DMRDPAAVAAAVRPGRTRLIWAETPANPTWEVTDLAACAEIAHRAGARLAVDNTVPTPLL 185 Query: 194 QRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFL 253 RP+ GAD+V+HSATKYLNGHSD++GG E++A ++ + G + GPF+++L Sbjct: 186 TRPVEHGADIVMHSATKYLNGHSDVLGGALATARADGFWERIAAIRANQGAIPGPFEAWL 245 Query: 254 ALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQM-SGFGGI 312 LRG++TL LR+ C A LA+ HP +E V+YPGL +HP H +A RQM GFGG+ Sbjct: 246 LLRGMRTLGLRVERACATAQRLAEHFAGHPKLEAVLYPGLPTHPGHAVAARQMRGGFGGM 305 Query: 313 VSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDAL 372 +S+ +KGG A ++T A SLGGVESLV H + P + L Sbjct: 306 LSVRVKGGAAGAVAASAALRIWTRATSLGGVESLVEHRGSIEGPDSPCPQ--------DL 357 Query: 373 VRLSVGIEDLGDLRGDLERAL 393 +RLS GIE DL DLE+AL Sbjct: 358 LRLSCGIEHADDLIADLEQAL 378 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 383 Length adjustment: 30 Effective length of query: 367 Effective length of database: 353 Effective search space: 129551 Effective search space used: 129551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory