Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_011881769.1 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000016205.1:WP_011881769.1 Length = 396 Score = 275 bits (703), Expect = 2e-78 Identities = 162/396 (40%), Positives = 231/396 (58%), Gaps = 17/396 (4%) Query: 12 DRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGE--------HQGFEYSRTHN 63 D +L+ TLA+ G ++ TS++ S + F YSR N Sbjct: 2 DDSLNFDTLAVRAGTQRS-EYNEHSEALFLTSSFCFKSAADAAERFANSEDYFTYSRFTN 60 Query: 64 PTRFAYERCVAALEGGTRAFAFASGMAAT-STVMELLDAGSHVVAMDDLYGGTFRLFERV 122 PT ++ +AALEGG A ASGMAA S VM L AG H+V+ L+G T +F ++ Sbjct: 61 PTVSMFQDRLAALEGGEACIATASGMAAIMSVVMSALQAGDHLVSSRSLFGSTLGMFSQI 120 Query: 123 RRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLT 182 + G+ +FVD TD A++ A+R +TKM ++ETP+NP+ +L DI AI IA+ L Sbjct: 121 FSKF-GITTTFVDPTDLNAWREAVRPETKMFFLETPSNPLTELADIEAIGKIAKAANALF 179 Query: 183 VVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSI 242 VVDN F SP+LQ+PL LGAD+V+HSATK+L+G ++GG A+VG + ++ S Sbjct: 180 VVDNCFCSPVLQQPLKLGADVVMHSATKFLDGQGRVLGG-ALVGSKEFIMGKVFPFVRSA 238 Query: 243 GGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLA 302 G F++++ L+G++TL LR+ NAL +A+WL+ HPA+ +V YPGL SHPQ+ LA Sbjct: 239 GPTLSAFNAWVLLKGMETLSLRVEKQSANALEIARWLDAHPAVARVFYPGLESHPQYELA 298 Query: 303 KRQMSGFGGIVSIVLKGGFDA-----AKRFCEKTELFTLAESLGGVESLVNHPAVMTHAS 357 KRQ G IVS LKG A R + T+L ++ +LG + + HPA THA Sbjct: 299 KRQQKAGGAIVSFELKGDTPEQQRANAWRVIDGTQLISITGNLGDTRTTITHPATTTHAR 358 Query: 358 IPVARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393 + R GI++ L+RL+VG+E GDLR DL R L Sbjct: 359 VTPEARAAAGITEGLIRLAVGLEYAGDLRNDLARGL 394 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 396 Length adjustment: 31 Effective length of query: 366 Effective length of database: 365 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory