Align 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 (characterized)
to candidate WP_012101381.1 CKL_RS04955 3-dehydroquinase
Query= SwissProt::Q186A6 (255 letters) >NCBI__GCF_000016505.1:WP_012101381.1 Length = 255 Score = 268 bits (686), Expect = 6e-77 Identities = 130/247 (52%), Positives = 188/247 (76%), Gaps = 1/247 (0%) Query: 5 VQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKE 64 V+++++ +GEG PKI VP++G N+++I++E +K LDI+EWR+D+++ VE +++VK+ Sbjct: 5 VKIRDVKLGEGIPKIAVPLVGSNEEEIMEEIAGVKTTKLDIVEWRIDYYKYVEEVEKVKK 64 Query: 65 VLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMG-DE 123 +L ++R +++IP+L TFR+ EGG++ IS +YY LNK I+ TG D+ID+ELF DE Sbjct: 65 LLQKMRKNLNNIPILVTFRTAKEGGKREISLEYYIELNKAIAATGNTDMIDIELFAAEDE 124 Query: 124 VIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVL 183 + ++V H+ +KVI+SNHDF+KTP K+E++SR+CRMQ+LGAD+ KIAVMP + KDVL Sbjct: 125 AVKKIVEELHEYNIKVIMSNHDFHKTPHKDELISRMCRMQQLGADIAKIAVMPCSTKDVL 184 Query: 184 VLLEATNEMFKIYADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKEL 243 LL AT EM + D PIITMSM +GVI+RL GE FGSALTFG+AK+ SAPGQ+ EL Sbjct: 185 ELLSATCEMKCKHNDTPIITMSMGTLGVITRLAGETFGSALTFGSAKAASAPGQLEVNEL 244 Query: 244 NSVLNLL 250 VL L+ Sbjct: 245 YKVLKLI 251 Lambda K H 0.319 0.138 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_012101381.1 CKL_RS04955 (3-dehydroquinase)
to HMM TIGR01093 (aroD: 3-dehydroquinate dehydratase, type I (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01093.hmm # target sequence database: /tmp/gapView.26274.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01093 [M=229] Accession: TIGR01093 Description: aroD: 3-dehydroquinate dehydratase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-79 252.4 1.0 3.3e-79 252.2 1.0 1.0 1 lcl|NCBI__GCF_000016505.1:WP_012101381.1 CKL_RS04955 3-dehydroquinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016505.1:WP_012101381.1 CKL_RS04955 3-dehydroquinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 252.2 1.0 3.3e-79 3.3e-79 1 228 [. 18 247 .. 18 248 .. 0.97 Alignments for each domain: == domain 1 score: 252.2 bits; conditional E-value: 3.3e-79 TIGR01093 1 kilvpltakdleealeelekikevgaDivElRvDllkdvsseksveavaeqlsellkdlplilTiRtqk 69 ki+vpl+ + ee++ee+ +k++ DivE+R+D++k v++ ++v+++ +++++ l+++p+++T+Rt+k lcl|NCBI__GCF_000016505.1:WP_012101381.1 18 KIAVPLVGSNEEEIMEEIAGVKTTKLDIVEWRIDYYKYVEEVEKVKKLLQKMRKNLNNIPILVTFRTAK 86 699****************************************************************** PP TIGR01093 70 eGGkfkgdeeerleelkeaieknlvdlvDiElkle.eeavkelikeakkaktkiilSnHdfektpskee 137 eGGk + + e+++e++k+++ ++ d++DiEl+++ +eavk++++e ++ ++k+i+SnHdf+ktp k+e lcl|NCBI__GCF_000016505.1:WP_012101381.1 87 EGGKREISLEYYIELNKAIAATGNTDMIDIELFAAeDEAVKKIVEELHEYNIKVIMSNHDFHKTPHKDE 155 ********************************9751678999*************************** PP TIGR01093 138 lverlekaqsldaDivKiavmaksieDvltLleitlkveeek.dkplialsMgekGkisRvlgavlgsv 205 l++r+ ++q+l+aDi+Kiavm+ s++Dvl+Ll++t +++ ++ d p+i++sMg G i+R++g+ +gs+ lcl|NCBI__GCF_000016505.1:WP_012101381.1 156 LISRMCRMQQLGADIAKIAVMPCSTKDVLELLSATCEMKCKHnDTPIITMSMGTLGVITRLAGETFGSA 224 **************************************98888************************** PP TIGR01093 206 ltfgslgkasAPGQisvkelrel 228 ltfgs++ asAPGQ++v+el ++ lcl|NCBI__GCF_000016505.1:WP_012101381.1 225 LTFGSAKAASAPGQLEVNELYKV 247 *******************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (229 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.56 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory