Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_012101829.1 CKL_RS07090 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000016505.1:WP_012101829.1 Length = 399 Score = 214 bits (546), Expect = 5e-60 Identities = 131/409 (32%), Positives = 223/409 (54%), Gaps = 25/409 (6%) Query: 340 VVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGD-----TTDHLIELAKTI 394 +V+ KFGG ++S E+ E+V KI+K K G PVVV+SAMG TD L+ L K Sbjct: 3 IVIQKFGGTSVSTHERREQVVNKILKAKDKGFCPVVVVSAMGRKGQPYATDTLLSLIKED 62 Query: 395 DENPDPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDIN 454 + +P +DLL+S GEI S +++ L +G KA+ TG Q IITD Y +A I+ + Sbjct: 63 FKIKNPLGVDLLISCGEIISTVVLADELLSQGVKAVPLTGGQAGIITDDTYNNASILKVK 122 Query: 455 TDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDG 514 + + + + IP+VAGFQG +E+G ITTLGRGGSD+TA L +L ++ E+Y DVDG Sbjct: 123 KERLLNLINEGKIPIVAGFQGESESGHITTLGRGGSDVTASILGVALDSESIEIYTDVDG 182 Query: 515 VYTADPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRG 574 + TADP IV +A +I+++S+ E+ + + GA+V+ RA + A V +++KN + +G Sbjct: 183 IMTADPGIVSEAFLIEQISYNEVFQFADQGAKVIHPRAVKIAMSGNVPLVVKNTLNDCKG 242 Query: 575 TLIWEGTKVE-NPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGM 633 T+I E + ++ +T D +V + + + + ++ ++ ++ID+I Sbjct: 243 TIITNSVIGESDKVISGITSMDNRIQVTV-NYNENNKIYNTLLEEMANNSISIDLI---- 297 Query: 634 KSGEYNTVAFIVPESQLGKLD-IDLLKTRSEAKEIIIEKGL----AKVSIVGVNLTSTPE 688 + P Q+ +D D+ + A + + L +K++++G + P Sbjct: 298 ---------NVFPSKQIFTIDNKDIGNFKIVAGNLALVYSLIENCSKIALIGSGMRGIPG 348 Query: 689 ISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELD 737 + A + + L EGI + + S + I ++ + A+ A+H F LD Sbjct: 349 VMARILKVLYEEGIEVLQTADSHTTIWCLVKSSETKRAINALHKEFLLD 397 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 399 Length adjustment: 35 Effective length of query: 704 Effective length of database: 364 Effective search space: 256256 Effective search space used: 256256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory