Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_011938713.1 GURA_RS09220 chorismate synthase
Query= SwissProt::O66493 (398 letters) >NCBI__GCF_000016745.1:WP_011938713.1 Length = 393 Score = 430 bits (1106), Expect = e-125 Identities = 226/399 (56%), Positives = 287/399 (71%), Gaps = 15/399 (3%) Query: 7 RFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQRGYGRGGRMKIEKDTAEILSG 66 R+LTAGESHG LTAI+EGIPA L LSEE+IN +L RRQ GYGRGGRM IEKD EILSG Sbjct: 3 RYLTAGESHGPQLTAIIEGIPAGLSLSEEQINIDLARRQCGYGRGGRMLIEKDQVEILSG 62 Query: 67 VRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVVPFTRPRPGHADLSGGIKYNQRD 126 VR+GKT+GSPI L +RNRDWENW EKM+ + TR RPGHADL G +KYN D Sbjct: 63 VRWGKTIGSPITLCVRNRDWENWHEKMSPHERFHDDKIRVTRSRPGHADLPGAMKYNHHD 122 Query: 127 LRNILERASARETAARVAVGAVCKKFLSEFGIKIGSFVVSIGQKEVEELKDKSYFANPEK 186 +RNILER+SARETA RVAVGAV K LS+F I++ FV +G ++ ++ Sbjct: 123 VRNILERSSARETAVRVAVGAVAKALLSQFEIEVCGFVAELG--GIKAIRPSL------P 174 Query: 187 LLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGESLGGVFEVFALNVPPGLGSHIQWD 246 L + + A SEL +EE K ID V+++G+++GGV EV A+ VPPGLGSH+QWD Sbjct: 175 LAALKDMAAKSELFTYDKSVEEEMKRLIDTVRDEGDTVGGVIEVNAVGVPPGLGSHVQWD 234 Query: 247 RRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQVHDEIGW-------SEGKGYFRHSN 299 R++D R+A A++SIQA KGVEIG+GF+AA GS+VHDEI + E G++R SN Sbjct: 235 RKLDARLAMAVLSIQAFKGVEIGIGFQAAASTGSKVHDEIFYDSARIAHGEQSGFYRKSN 294 Query: 300 NLGGTEGGITNGMPIVVRVAMKPIPTLKNPLRSVDIETKEEMKAGKERTDIVAVPAASVV 359 N GG EGGI+NG IVVR AMKPIPTL PLRSVDI +KE +A ER+D+ AVPAASVV Sbjct: 295 NAGGIEGGISNGEEIVVRAAMKPIPTLYKPLRSVDIVSKEPYEATVERSDVCAVPAASVV 354 Query: 360 GEAMLAIVLADALLEKLGGDFMEEVKKRFEDYVNHVKSF 398 EA++AI LADA + K GGD + E+K+ ++ Y++++++F Sbjct: 355 AEAVVAIELADAFMVKFGGDSITEIKRNYQSYLDYLRAF 393 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 393 Length adjustment: 31 Effective length of query: 367 Effective length of database: 362 Effective search space: 132854 Effective search space used: 132854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011938713.1 GURA_RS09220 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.2914.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-129 417.2 0.1 2.8e-129 417.0 0.1 1.0 1 lcl|NCBI__GCF_000016745.1:WP_011938713.1 GURA_RS09220 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016745.1:WP_011938713.1 GURA_RS09220 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.0 0.1 2.8e-129 2.8e-129 1 349 [. 2 372 .. 2 374 .. 0.92 Alignments for each domain: == domain 1 score: 417.0 bits; conditional E-value: 2.8e-129 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r++t+GeSHg++l+aii+G+Pagl+l+ee+i+ +l+rR+ g++r+ rm E+D+veilsGv+ GkT G lcl|NCBI__GCF_000016745.1:WP_011938713.1 2 FRYLTAGESHGPQLTAIIEGIPAGLSLSEEQINIDLARRQCGYGRGGRMLIEKDQVEILSGVRWGKTIG 70 89******************************************************************* PP TIGR00033 70 aPiallikNkd.......vrskdyed......ikelpRPgHadytylkKYgikd.regggrsSaReTaa 124 +Pi+l ++N+d +++++ ++ RPgHad+ + KY+ +d r++++rsSaReTa+ lcl|NCBI__GCF_000016745.1:WP_011938713.1 71 SPITLCVRNRDwenwhekMSPHE--RfhddkiRVTRSRPGHADLPGAMKYNHHDvRNILERSSARETAV 137 ***********988887744433..133455567899******************************** PP TIGR00033 125 rvaaGavakklLketagieivayvvklgevelee.esakeiskerldkspvrcpdaeaekemeeeidka 192 rva+Gavak+lL++ +ie+ ++v +lg +++ + + k+ ++ks+++ +d++ e+em+ +id++ lcl|NCBI__GCF_000016745.1:WP_011938713.1 138 RVAVGAVAKALLSQ-FEIEVCGFVAELGGIKAIRpSLPLAALKDMAAKSELFTYDKSVEEEMKRLIDTV 205 **************.55************7665505555889999999********************* PP TIGR00033 193 kkdgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDel 259 +++gd+vGgv+ev + +vp glG +++++klda+la a+lsi+A+KgveiG GF+aa +Gs+++De+ lcl|NCBI__GCF_000016745.1:WP_011938713.1 206 RDEGDTVGGVIEVNAVGVPPGLGshVQWDRKLDARLAMAVLSIQAFKGVEIGIGFQAAASTGSKVHDEI 274 ***********************9999*****************************************9 PP TIGR00033 260 vle........ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRh 320 ++ + ++ rk+nn GGieGGi+nGe+i+vr+a+Kpipt++kpl++vd+ ke+++at++R+ lcl|NCBI__GCF_000016745.1:WP_011938713.1 275 FYDsariahgeQSGFYRKSNNAGGIEGGISNGEEIVVRAAMKPIPTLYKPLRSVDIVSKEPYEATVERS 343 87621111112445679**************************************************** PP TIGR00033 321 DpcvvpravpvvEamvalvladallekra 349 D+c+vp+a++v+Ea+va+ lada++ k++ lcl|NCBI__GCF_000016745.1:WP_011938713.1 344 DVCAVPAASVVAEAVVAIELADAFMVKFG 372 ***********************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory