Align ATP-dependent reduction of co(II)balamin (characterized)
to candidate WP_011940644.1 GURA_RS19590 DUF4445 domain-containing protein
Query= reanno::DvH:206336 (543 letters) >NCBI__GCF_000016745.1:WP_011940644.1 Length = 427 Score = 149 bits (376), Expect = 2e-40 Identities = 138/440 (31%), Positives = 192/440 (43%), Gaps = 43/440 (9%) Query: 120 PFRLAVDLGTTSLQWSLL-APDGTVAAQGSETNPQMGAGSDVMSRIAMARSDKGR-GRLR 177 P +A+D+GTT++ SLL G A NPQ G+DV+SR+A A S R+ Sbjct: 6 PVAVAIDVGTTTIAASLLDCESGERLAMTGSLNPQREFGADVVSRLAAAVSSADNLFRMS 65 Query: 178 ELVLQALRRIVADVEGTPATADAVPPAGSGDEPTTACGYESRVEELCVAGNTAMTAILAD 237 +L+ L R+ T + G+ G +AGN A+ +L Sbjct: 66 KLINAELERL---------TVKLLDDCGAARRDLRCIG---------IAGNPAIEHLLLG 107 Query: 238 ESVEGLASAPYRLEMRGGTALALPGLP-----PAWIPPLPAPFVGGDLSA-----GYLAV 287 SV+ LA PYR G + L A+I PLP FVGGDL A G A Sbjct: 108 LSVKSLAFPPYRPLFSAGKTMTTASLGWGLDLDAYIFPLPGGFVGGDLVAFLYGEGVCAA 167 Query: 288 -LTDHAPAFPFVLADLGTNGEFVLALSPERTLVTSVALGPALEGIGLTFGTVAQRGAITS 346 T HA + DLGTNGE L ++ + TS A GPA EG L G A GAI+ Sbjct: 168 HSTQHAAR---LYLDLGTNGELAL-VAGGKIYATSAAAGPAFEGGNLACGMAALPGAISG 223 Query: 347 FTLTPGGLVPYVLDGGEAD-GISGTGYISLVHALLRAGLLDVDGRFIQSPSSPLAARMAR 405 + G V G EA GI G+G I+ V LL AG+LD GR +++ P + +A Sbjct: 224 VSFA-GDKVGIATIGNEAPTGICGSGVIAAVAGLLEAGILDQSGRLLEADEIP--SNLAN 280 Query: 406 SIVSHRGEPCLPLARG----LYLAARDIEEILKVKAAFSLAFERLLATAQMPSHALSGIH 461 + + GE R +YL+ DI ++ K A E LL A + ++ + Sbjct: 281 HVRNVDGETGFVFYRDARRTIYLSQGDIRQVQLAKGAIRAGMEVLLQRAGISGDSIQEVV 340 Query: 462 LAGALGQHALPADLEGLGFIPPGSGGRTRAVGNTSLRGAELLLTSPPLRDTLNTWREGCT 521 L G+ G P L+ +G V +LRG E + + L+ E Sbjct: 341 LTGSFGAILSPEHLKNVGIFSENMVKNAGFVHEGALRGVEKAICAGDDFAALDRLAESIK 400 Query: 522 VVDLTAAPDFSAAFLRHMHF 541 V+ L+ P F FL HM+F Sbjct: 401 VIPLSGTPAFEKHFLEHMNF 420 Lambda K H 0.320 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 568 Number of extensions: 24 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 543 Length of database: 427 Length adjustment: 34 Effective length of query: 509 Effective length of database: 393 Effective search space: 200037 Effective search space used: 200037 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_011940644.1 GURA_RS19590 (DUF4445 domain-containing protein)
to HMM PF14574 (RACo_C_ter)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF14574.10.hmm # target sequence database: /tmp/gapView.30681.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: RACo_C_ter [M=261] Accession: PF14574.10 Description: C-terminal domain of RACo the ASKHA domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-65 206.6 0.9 2.7e-65 206.1 0.9 1.2 1 lcl|NCBI__GCF_000016745.1:WP_011940644.1 GURA_RS19590 DUF4445 domain-cont Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016745.1:WP_011940644.1 GURA_RS19590 DUF4445 domain-containing protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 206.1 0.9 2.7e-65 2.7e-65 3 251 .. 175 422 .. 173 426 .. 0.94 Alignments for each domain: == domain 1 score: 206.1 bits; conditional E-value: 2.7e-65 RACo_C_ter 3 slliDiGTNaEivlgnkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvignekp 71 l++D+GTN+E++l +++a+saaaGPA+EGg++ cGm A pgAi+ v++ ++ v + +igne+p lcl|NCBI__GCF_000016745.1:WP_011940644.1 175 RLYLDLGTNGELALVAGGKIYATSAAAGPAFEGGNLACGMAALPGAISGVSFAGDK--VGIATIGNEAP 241 589*************************************************9998..9********** PP RACo_C_ter 72 kGicGsGiidliaelleagiidkkgklnkel.....kserireeeeteeyvlvlaeesetekdivitek 135 +GicGsG+i+++a lleagi+d++g+l + +++r+ ++++ +v + + ++ i++++ lcl|NCBI__GCF_000016745.1:WP_011940644.1 242 TGICGSGVIAAVAGLLEAGILDQSGRLLEADeipsnLANHVRNVDGETGFVFYRDA----RRTIYLSQG 306 **************************977653443345667777888888887654....579****** PP RACo_C_ter 136 DidelirakaAiyagvktLleevglevedidkvylaGafGsyidlekAitiGllPdlelekvkqvGNts 204 Di++++ ak+Ai+ag+++Ll+++g++ ++i++v+l+G+fG+ + +e+ ++G++ + +++ +v ++ lcl|NCBI__GCF_000016745.1:WP_011940644.1 307 DIRQVQLAKGAIRAGMEVLLQRAGISGDSIQEVVLTGSFGAILSPEHLKNVGIFSENMVKNAGFVHEGA 375 ********************************************************************* PP RACo_C_ter 205 lagAraallsreareeleeiarkityielavekkFmeefvaalflph 251 l+g ++a++ + ++ l+++a++i+ i l+ +++F+++f++ + +p+ lcl|NCBI__GCF_000016745.1:WP_011940644.1 376 LRGVEKAICAGDDFAALDRLAESIKVIPLSGTPAFEKHFLEHMNFPK 422 *********************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (427 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory