Align Metal-independent phosphoserine phosphatase; iPSP; Phosphoglycerate mutase-like protein 3; EC 3.1.3.3 (characterized)
to candidate WP_011940959.1 GURA_RS21280 alpha-ribazole phosphatase
Query= SwissProt::F4KI56 (238 letters) >NCBI__GCF_000016745.1:WP_011940959.1 Length = 200 Score = 73.6 bits (179), Expect = 3e-18 Identities = 60/194 (30%), Positives = 88/194 (45%), Gaps = 8/194 (4%) Query: 25 TEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLGKEERPVAVYSSDLKRAK 84 T I L+RHGE R G + L G+ Q + ER E A Y+SDL R Sbjct: 5 TRIYLIRHGEVVGAGTRRYNGHADVALTPHGMAQYEMLKERFAGIEIS-ACYTSDLTRCV 63 Query: 85 DTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLEIPGG 144 A ++ V + +L+E +VG +G W E EK P + A + + +P G Sbjct: 64 MGAELLGSHLGVKPV-KHRELRELNVGIWEGKTWNELMEKYPTEWQARLNDIVNYRVPEG 122 Query: 145 GESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYLRITQASSAGKLLNASVNVV 204 D + +R M + I +H+GE V++V HGGV R I L ++ G L+A NV Sbjct: 123 ENLLD-VNNRVMPVVSDIVARHRGENVLIVAHGGVNRLILL-----NAIGAPLSALFNVE 176 Query: 205 HLRDQKWIIDSWSD 218 +ID + D Sbjct: 177 QSYCGFNVIDYYED 190 Lambda K H 0.315 0.132 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 200 Length adjustment: 22 Effective length of query: 216 Effective length of database: 178 Effective search space: 38448 Effective search space used: 38448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory