Align Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (characterized)
to candidate WP_012049347.1 SWIT_RS15935 O-succinylhomoserine (thiol)-lyase
Query= SwissProt::P00935 (386 letters) >NCBI__GCF_000016765.1:WP_012049347.1 Length = 390 Score = 427 bits (1098), Expect = e-124 Identities = 217/376 (57%), Positives = 273/376 (72%), Gaps = 1/376 (0%) Query: 7 TIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEG 66 TI+ G+ D +G V PP++LSSTY F G+++PR +DY R GNPTRD++ ALA+LEG Sbjct: 13 TISAAHGVATDAGFGAVAPPLYLSSTYAFAGYDQPRHYDYGRAGNPTRDLLAEALAKLEG 72 Query: 67 GAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGD 126 GAGA++T++GM+A+ L+ L+P DL++APHDCYGG+ RL + A RG V FVDQ D Sbjct: 73 GAGAIVTSSGMAALDLLVGR-LRPDDLVLAPHDCYGGTMRLLKARAGRGHCSVRFVDQTD 131 Query: 127 EQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLA 186 +A AL E P LVL+E+PSNPL+RVVDIA + LAR GA VDNTFLSPA+Q P+A Sbjct: 132 MRAFAGALDEVPALVLIETPSNPLMRVVDIAALSALARAAGAEVAVDNTFLSPAIQRPIA 191 Query: 187 LGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLR 246 LGAD +HS TKYLNGHSDV+ G V+A DP V L WAN +G G FDS+L LRGLR Sbjct: 192 LGADYAIHSTTKYLNGHSDVIGGAVVAADPAQVEALRHWANVVGSAGAPFDSWLTLRGLR 251 Query: 247 TLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDG 306 TL PRME Q NA A+ +L+ P V ++++P L + GH IA+RQQ+GFGAMLSFEL G Sbjct: 252 TLFPRMEQQQINAMAVANHLERHPAVARVHYPGLASHPGHAIASRQQRGFGAMLSFELAG 311 Query: 307 DEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGI 366 +RRF+ + FTLAESLGGVESL++H ATMTHA M EARAAAGIS++LLR+S G+ Sbjct: 312 GVAAVRRFIDAVRFFTLAESLGGVESLVAHPATMTHADMGEEARAAAGISDSLLRLSVGL 371 Query: 367 EDGEDLIADLENGFRA 382 E DLIA L+ G A Sbjct: 372 EAERDLIAGLDKGLAA 387 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 390 Length adjustment: 30 Effective length of query: 356 Effective length of database: 360 Effective search space: 128160 Effective search space used: 128160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012049347.1 SWIT_RS15935 (O-succinylhomoserine (thiol)-lyase)
to HMM TIGR02080 (metB: O-succinylhomoserine (thiol)-lyase (EC 2.5.1.48))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02080.hmm # target sequence database: /tmp/gapView.29424.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02080 [M=382] Accession: TIGR02080 Description: O_succ_thio_ly: O-succinylhomoserine (thiol)-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-189 615.8 0.0 1.4e-189 615.6 0.0 1.0 1 lcl|NCBI__GCF_000016765.1:WP_012049347.1 SWIT_RS15935 O-succinylhomoserin Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016765.1:WP_012049347.1 SWIT_RS15935 O-succinylhomoserine (thiol)-lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 615.6 0.0 1.4e-189 1.4e-189 3 382 .] 10 388 .. 8 388 .. 0.99 Alignments for each domain: == domain 1 score: 615.6 bits; conditional E-value: 1.4e-189 TIGR02080 3 kkatiavrsGlesdkqygavvpPiylsttyefagfnepraydysrsgnPtrdllekalaelekGadavv 71 + +ti++++G+++d +gav pP+yls+ty+fag+++pr+ydy+r gnPtrdll++ala+le+Ga+a+v lcl|NCBI__GCF_000016765.1:WP_012049347.1 10 RPQTISAAHGVATDAGFGAVAPPLYLSSTYAFAGYDQPRHYDYGRAGNPTRDLLAEALAKLEGGAGAIV 78 578****************************************************************** PP TIGR02080 72 tssGmsaiellviallkpddllvaPhdcyGGtyrllkalakkgklkvqlvdqsdeealekalaekpklv 140 tssGm+a++llv ++l+pddl++aPhdcyGGt+rllka+a +g++ v++vdq+d++a++ al e p+lv lcl|NCBI__GCF_000016765.1:WP_012049347.1 79 TSSGMAALDLLV-GRLRPDDLVLAPHDCYGGTMRLLKARAGRGHCSVRFVDQTDMRAFAGALDEVPALV 146 ***********9.******************************************************** PP TIGR02080 141 lietPsnPllrvvdiaklcklakaagavvvvdntflsPilqkPlalGadlvlhsatkylnGhsdviaGa 209 lietPsnPl+rvvdia+l+ la+aaga v+vdntflsP++q+P+alGad+++hs+tkylnGhsdvi+Ga lcl|NCBI__GCF_000016765.1:WP_012049347.1 147 LIETPSNPLMRVVDIAALSALARAAGAEVAVDNTFLSPAIQRPIALGADYAIHSTTKYLNGHSDVIGGA 215 ********************************************************************* PP TIGR02080 210 viakdkqlaeelawwanalGvtgaafdsylllrGlrtlaarvreqernakkiveylqkqplvkkvyypg 278 v+a+d+ ++e l++wan++G++ga+fds+l+lrGlrtl+ r+++q+ na++++++l+++p+v +v+ypg lcl|NCBI__GCF_000016765.1:WP_012049347.1 216 VVAADPAQVEALRHWANVVGSAGAPFDSWLTLRGLRTLFPRMEQQQINAMAVANHLERHPAVARVHYPG 284 ********************************************************************* PP TIGR02080 279 lpdhagheiaakqqkGfGallsfelkGgeeevkkflkklklftlaeslGGvesliahpatmthaameke 347 l++h+gh+ia +qq+GfGa+lsfel+Gg+++v++f+++++ ftlaeslGGvesl+ahpatmtha+m++e lcl|NCBI__GCF_000016765.1:WP_012049347.1 285 LASHPGHAIASRQQRGFGAMLSFELAGGVAAVRRFIDAVRFFTLAESLGGVESLVAHPATMTHADMGEE 353 ********************************************************************* PP TIGR02080 348 areeaGikdellrlsvGledaddliadleqalaav 382 ar++aGi+d+llrlsvGle dlia+l+++laa+ lcl|NCBI__GCF_000016765.1:WP_012049347.1 354 ARAAAGISDSLLRLSVGLEAERDLIAGLDKGLAAC 388 ********************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (382 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory