Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_029549163.1 SWIT_RS06095 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000016765.1:WP_029549163.1 Length = 402 Score = 257 bits (656), Expect = 5e-73 Identities = 156/385 (40%), Positives = 226/385 (58%), Gaps = 14/385 (3%) Query: 18 ATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPG--------EHQGFEYSRTHNPTRFAY 69 AT AI GG + G ++ TS YA G E +G YSR NPT Sbjct: 18 ATQAIRGGTARS-HYGETSEALFLTSGYAYDCAGDAAARFAGEQKGMTYSRLQNPTVEML 76 Query: 70 ERCVAALEGGTRAFAFASGMAA-TSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAG 128 E +A +EG A + ASGMAA T+ ++ L AG H+VA +G L + + R G Sbjct: 77 EERIALMEGAEAARSMASGMAAMTAALLCQLSAGDHLVAGRAAFGSCRWLTDTLLPRF-G 135 Query: 129 LDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTF 188 ++ + VD D A+KAAIR +TK+ + ETP NP L +VD+ A+ IAR G++TVVDN F Sbjct: 136 VETTIVDGRDNDAWKAAIRPNTKLFFFETPANPTLDIVDMEAVCRIARDAGIVTVVDNAF 195 Query: 189 ASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGP 248 A+P+LQRPL GAD+V +SATK ++G ++ G AV G A + + + G P Sbjct: 196 ATPLLQRPLDYGADVVAYSATKMMDGQGRVLAG-AVCGTEAFINTTLLSFTRNTGPTLSP 254 Query: 249 FDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSG 308 F++++ L+GL+TL LR+R ENAL +A++LE + +V++P L SHPQH LA +QMS Sbjct: 255 FNAWVVLKGLETLDLRIRRQSENALQVARFLEGR--VPRVLFPALPSHPQHALAMKQMSA 312 Query: 309 FGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGI 368 G I+SI L GG A + EL ++ ++G SL+ HPA THA + R ++G+ Sbjct: 313 GGTIISIYLDGGRPQAHGLLDALELVDISNNIGDSRSLMTHPASTTHAGLSAEVRAEMGV 372 Query: 369 SDALVRLSVGIEDLGDLRGDLERAL 393 + ++RL+VG+ED D+ D +RAL Sbjct: 373 EEGMLRLNVGLEDPLDVIEDFDRAL 397 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 402 Length adjustment: 31 Effective length of query: 366 Effective length of database: 371 Effective search space: 135786 Effective search space used: 135786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory