Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_012050261.1 SWIT_RS20630 branched-chain amino acid aminotransferase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_000016765.1:WP_012050261.1 Length = 294 Score = 223 bits (568), Expect = 4e-63 Identities = 121/292 (41%), Positives = 175/292 (59%), Gaps = 10/292 (3%) Query: 5 DRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKRLL 64 DRDG IWMDG L+ WR A +HVLTH LHY VFEGVRAY+ GT IF L H++RL Sbjct: 9 DRDGFIWMDGALVPWRAANVHVLTHALHYASSVFEGVRAYE----GT-IFELSRHSRRLR 63 Query: 65 NSAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVAIA 124 SA++ ++P+ E + AA E + N L+ Y+RP+ W GSE++GVSA H+AIA Sbjct: 64 ESARLLGFELPWSVEAIDAACIETLAANGLKDAYVRPVAWRGSEQMGVSAIRTRPHLAIA 123 Query: 125 AWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEA 184 W WG+Y D A G+R+ + + R + V+AKASG Y+ + ++ A G+ +A Sbjct: 124 CWAWGSYFDPD--AAGLRLDIAPWRRPPPYCAPVQAKASGHYMIATMSKHHAEGRGFHDA 181 Query: 185 LLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRITR 244 L+ D G V+E + N F V +G L+TP LDGITR TVI LAR GI V+E+ I Sbjct: 182 LMFDHRGQVAEATAANIFFVKDGALHTPTADCFLDGITRQTVIGLARRRGIAVVERAIWP 241 Query: 245 DEVYTCDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIVNGK 296 +E+ ++ F TG+AAE+ + + + +G G +++ + D+V G+ Sbjct: 242 EELEGFEQCFLTGSAAEIVGVASIGPWSFETGDLG---RQMRKDYADLVRGR 290 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 294 Length adjustment: 27 Effective length of query: 280 Effective length of database: 267 Effective search space: 74760 Effective search space used: 74760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_012050261.1 SWIT_RS20630 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.12458.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-82 260.6 0.0 1e-81 260.4 0.0 1.0 1 lcl|NCBI__GCF_000016765.1:WP_012050261.1 SWIT_RS20630 branched-chain amin Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000016765.1:WP_012050261.1 SWIT_RS20630 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 260.4 0.0 1e-81 1e-81 1 287 [. 15 290 .. 15 293 .. 0.97 Alignments for each domain: == domain 1 score: 260.4 bits; conditional E-value: 1e-81 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskee 69 w+dG lv+++ a+vhvlthalhY ++vfeG+RaYe+ +if l+ h Rl +sa+ l +e+p+s e lcl|NCBI__GCF_000016765.1:WP_012050261.1 15 WMDGALVPWRAANVHVLTHALHYASSVFEGVRAYEG----TIFELSRHSRRLRESARLLGFELPWSVEA 79 9***********************************....9**************************** PP TIGR01122 70 lvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssf 138 + +++e+l +n+lk+aY+Rp++++G+e++g+++ + ++++++ia w+wg y++ + G++ ++ + lcl|NCBI__GCF_000016765.1:WP_012050261.1 80 IDAACIETLAANGLKDAYVRPVAWRGSEQMGVSA-IRTRPHLAIACWAWGSYFDPD--AAGLRLDIAPW 145 **********************************.*******************98..68********* PP TIGR01122 139 rraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvses 207 rr + p +aka+g Y+ +++ k+ a +G+++a++ d+ G vae + nif vkdg+l tP + lcl|NCBI__GCF_000016765.1:WP_012050261.1 146 RRPPPYCAPVQAKASGHYMIATMSKHHAEGRGFHDALMFDHRGQVAEATAANIFFVKDGALHTPTA-DC 213 ****************************************************************99.99 PP TIGR01122 208 iLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkkl 276 L+gitr++vi la+++gi v+e+ i eel + fltG+aae++ + ++ + G++ +++ lcl|NCBI__GCF_000016765.1:WP_012050261.1 214 FLDGITRQTVIGLARRRGIAVVERAIWPEELEGFEQCFLTGSAAEIVGVASIGPWSFET---GDLGRQM 279 ****************************************************9998765...566699* PP TIGR01122 277 qeaffdlvegk 287 ++ + dlv+g+ lcl|NCBI__GCF_000016765.1:WP_012050261.1 280 RKDYADLVRGR 290 ********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.98 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory