Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate YP_001328229.1 Smed_2564 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >NCBI__GCF_000017145.1:YP_001328229.1 Length = 380 Score = 280 bits (715), Expect = 6e-80 Identities = 167/363 (46%), Positives = 222/363 (61%), Gaps = 8/363 (2%) Query: 3 RIVVTLGERSYPITIASGLFNEPASFLPLK-SGEQVMLVTNETLAPLYLDKVRGVLEQAG 61 ++ V L ERSY I I GL + + G ++ ++T+E +AP YL+ + L +G Sbjct: 15 KVRVDLAERSYDILIGPGLIAAAGGEIASRLKGRKMAVITDENVAPRYLEPLMASLAGSG 74 Query: 62 VNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQRG 121 ++ S+ILP GE+ KS L V A+L R+ ++ALGGGV+GDLTGFAA +RG Sbjct: 75 MDPVSLILPAGEKTKSFEHLIPVCEAVLGARIERNDAVIALGGGVIGDLTGFAAGIVRRG 134 Query: 122 VRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELASG 181 RFIQ+PT+LL+QVDSSVGGKT +N P GKN+IG F+QP V+ D L TL PRE +G Sbjct: 135 SRFIQIPTSLLAQVDSSVGGKTGINSPHGKNLIGVFHQPDLVLADTAALDTLSPREFRAG 194 Query: 182 LAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLRA 241 AEV+KYG+I FF WLE+N A+ GPA I C+ KA+VVAADERE GLRA Sbjct: 195 YAEVVKYGLIDKPDFFEWLEQNWQAVF-AGGPARIEAIAVSCQAKADVVAADERENGLRA 253 Query: 242 LLNLGHTFGHAIEAEMGYGN--WLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKR 299 LLNLGHTFGHA+EA GY + +HGE VA GMV+A S R+ S + +R+ LK Sbjct: 254 LLNLGHTFGHALEAATGYDSKRLVHGEGVAIGMVLAHEFSARMNIASPDDARRVEMHLKT 313 Query: 300 AGLP---VNGPREM-SAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNA 355 GLP + P + A L + +DKKV G+ IL IG+S + V VL+ Sbjct: 314 VGLPTRMADIPGMLPPADRLLEAIAQDKKVKGGKFTFILTRGIGQSFIADDVPSSEVLSF 373 Query: 356 IAD 358 + + Sbjct: 374 LEE 376 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 380 Length adjustment: 30 Effective length of query: 332 Effective length of database: 350 Effective search space: 116200 Effective search space used: 116200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate YP_001328229.1 Smed_2564 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.9394.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-111 357.0 0.0 6.2e-111 356.8 0.0 1.0 1 lcl|NCBI__GCF_000017145.1:YP_001328229.1 Smed_2564 3-dehydroquinate synth Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017145.1:YP_001328229.1 Smed_2564 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.8 0.0 6.2e-111 6.2e-111 1 341 [. 25 372 .. 25 375 .. 0.97 Alignments for each domain: == domain 1 score: 356.8 bits; conditional E-value: 6.2e-111 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKslet 67 y++ +g gl++++ e+a+ k +k+ vitde+v+ + e l + l+ g+ l++p+ge++Ks+e+ lcl|NCBI__GCF_000017145.1:YP_001328229.1 25 YDILIGPGLIAAAGGEIASrlKGRKMAVITDENVAPRYLEPLMASLAGSGMDPVSLILPAGEKTKSFEH 93 6899*******999888887666********************************************** PP TIGR01357 68 vaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlpl 136 + + +++l + +er+++++a+GGGv+gDl+GF+A + RG r++q+PT+lla+vDssvGGKtgin p+ lcl|NCBI__GCF_000017145.1:YP_001328229.1 94 LIPVCEAVLGARIERNDAVIALGGGVIGDLTGFAAGIVRRGSRFIQIPTSLLAQVDSSVGGKTGINSPH 162 ********************************************************************* PP TIGR01357 137 gkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealee 205 gkNliG f+qP++Vl d++ l tl+ re+r+G+aEv+K+gli ++fe+le+n++++ a e lcl|NCBI__GCF_000017145.1:YP_001328229.1 163 GKNLIGVFHQPDLVLADTAALDTLSPREFRAGYAEVVKYGLIDKPDFFEWLEQNWQAVFA--GGPARIE 229 ********************************************************8884..679999* PP TIGR01357 206 likrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk...lsHGeaVaiGmvveaklseklgl 271 +i+ s++ Ka+vV++De+e+glRalLN+GHt+gHa+Ea+++y+ l HGe VaiGmv++ ++s ++ + lcl|NCBI__GCF_000017145.1:YP_001328229.1 230 AIAVSCQAKADVVAADERENGLRALLNLGHTFGHALEAATGYDskrLVHGEGVAIGMVLAHEFSARMNI 298 ******************************************99999********************** PP TIGR01357 272 lkaellerlvallkklglptklkk....klsveellkallkDKKnegskiklvlleeiGkaalasevte 336 +++++++r++ lk++glpt++ + ++ ll+a+ +DKK +g+k +++l + iG+ ++a++v++ lcl|NCBI__GCF_000017145.1:YP_001328229.1 299 ASPDDARRVEMHLKTVGLPTRMADipgmLPPADRLLEAIAQDKKVKGGKFTFILTRGIGQSFIADDVPS 367 ************************99987899***********************************99 PP TIGR01357 337 eelle 341 +e+l+ lcl|NCBI__GCF_000017145.1:YP_001328229.1 368 SEVLS 372 99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.05 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory