Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate YP_001314491.1 Smed_5864 NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase
Query= BRENDA::P9WNX3 (528 letters) >NCBI__GCF_000017145.1:YP_001314491.1 Length = 324 Score = 186 bits (472), Expect = 1e-51 Identities = 114/309 (36%), Positives = 170/309 (55%), Gaps = 11/309 (3%) Query: 3 LPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVLAA 62 + V+ L P A L ++R PD + LL A+ ++VR+ + Sbjct: 1 MSVIFSTHPLHPQAEALLKAAGDLRIASAPDPETLLREGAGAEIVIVRAR--IPPAFFQL 58 Query: 63 APKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAADA 122 A L+ V R G G+D + D ATA GVL+ N P +N + AEH L + LA RQ D Sbjct: 59 ASMLRAVIRHGAGIDMIPYDTATAAGVLIANVPGANALTVAEHVLMVSLALLRQFRPMDR 118 Query: 123 SLREHTW---KRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIA-AFGAYVVAYDPYVSPAR 178 LR W + S ++ G+T+G+VG+G +G+ V ++ FG +VA +PA Sbjct: 119 DLRNIGWSAGRAHSDRALDLAGRTMGIVGMGSVGKAVFRKAKYGFGLEIVANSR--APAS 176 Query: 179 AAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDE 238 G+ LS+DDL++ AD + + P TPET GL+ ++ +A+ KPG I+VN +RG +VD+ Sbjct: 177 LPH-GVRFLSVDDLVSTADIVVLCCPLTPETTGLVSRDRIARMKPGTILVNVSRGPVVDD 235 Query: 239 AALADAITGGHVRAAGLDVFATEPC-TDSPLFELAQVVVTPHLGASTAEAQDRAGTD-VA 296 AAL A+ GG + A LDVF+T+P + P F L V+VTPHL T E+ R GT+ A Sbjct: 236 AALIQALEGGRIGGAALDVFSTQPLPLEHPYFRLNNVIVTPHLAGITEESMMRMGTEAAA 295 Query: 297 ESVRLALAG 305 E++R+ G Sbjct: 296 EAIRVLEGG 304 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 324 Length adjustment: 31 Effective length of query: 497 Effective length of database: 293 Effective search space: 145621 Effective search space used: 145621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory