Align dihydroxy-acid dehydratase (EC 4.2.1.9) (characterized)
to candidate YP_001325992.1 Smed_0298 phosphogluconate dehydratase
Query= BRENDA::Q8NQZ9 (613 letters) >NCBI__GCF_000017145.1:YP_001325992.1 Length = 606 Score = 198 bits (503), Expect = 6e-55 Identities = 167/541 (30%), Positives = 250/541 (46%), Gaps = 49/541 (9%) Query: 37 VAIVNSYTQFVPGHVHLKNVGDIVADAVRKAGGVPKEFNTI-AVDDGIAMGHGGMLYSLP 95 + I+ SY + H + ++ +A +AGGV + + A+ DG+ G GM SL Sbjct: 70 LGIITSYNDMLSAHQPFETYPALIREAAHEAGGVAQVAGGVPAMCDGVTQGQPGMELSLF 129 Query: 96 SREIIADSVEYMVNAHTADAMVCISNCDKITPGMLNAAMRL-NIPVVFVSGGPMEAGKAV 154 SR++IA + ++ + DA V + CDKI PG+ AA+ ++P VF+ GPM +G Sbjct: 130 SRDVIAMAAGIGLSHNMFDAAVYLGVCDKIVPGLAIAALTFGHLPAVFIPAGPMTSG--- 186 Query: 155 VVDGVAHAPTDLITAI-SASASDAVDDAGLAAVEASACPTCGSCSGMFTANSMNCLTEAL 213 P D I A V L E+ + G+C+ TANS L E + Sbjct: 187 -------LPNDEKAKIRQLFAEGKVGRDELLEAESKSYHGPGTCTFYGTANSNQMLMEIM 239 Query: 214 GLSLPGNGSTLATHAARRALFEKAGETVVELCRRYYGEEDESVLPRG-IATKKAFENAMA 272 G LPG R AL ++A + + + G E P G + +++ N + Sbjct: 240 GFHLPGASFINPGTPLRDALTKEATKRALAITA--LGNE---FTPAGEMIDERSIVNGVV 294 Query: 273 LDMAMGGSTNTILHILAAAQEGEVDFDLADIDELSKNVPCLSKVAPNSDYHMEDVHRAGG 332 A GGSTN LH++A A+ + DI ELS VP L++V PN + H AGG Sbjct: 295 GLHATGGSTNHTLHLVAMARAAGIVLTWQDISELSDLVPLLARVYPNGLADVNHFHAAGG 354 Query: 333 IPALLGELNRGGLLNKDVHSVHSNDLEGWLDDWDIRSGKTTEVATELFHAAPGGIRTTEA 392 + ++ +L GLL+ DV +V+ L + D++ G+ V E AP + Sbjct: 355 MGFMIAQLLSKGLLHDDVRTVYGQGLSAYA--IDVKLGEKGSVKRE---PAPAVSADPKV 409 Query: 393 FSTENRWDELDTDAAKGCIRDVEHAYTADGGLVVLRGNISPDGAVIKSAGIEEELWNFTG 452 +T ++ + GGL +L GNI AVIK + ++ E Sbjct: 410 LAT------------------IDRPFQHTGGLKMLSGNIGK--AVIKISAVKPESHVIEA 449 Query: 453 PARVVESQEEAVSVILTKTIQAGEVLVVRYEGPSGGPGMQEMLHPTAFLKG--SGLGKKC 510 PA++ Q E + ++ V VVR++GP GM E LH + G G+K Sbjct: 450 PAKIFNGQGELNAAFKAGKLEGDFVAVVRFQGPKAN-GMPE-LHKLTTVLGILQDRGQKV 507 Query: 511 ALITDGRFSGGSSGLSIG-HVSPEAAHGGVIGLIENGDIVSIDVHNRKLEVQVSDEELQR 569 A++TDGR SG S + HV+PEA GG I I+ GDIV ID K+EV V D L+ Sbjct: 508 AILTDGRMSGASGKVPAAIHVTPEAKEGGPIARIQEGDIVRIDAIKGKIEVLVEDIALKT 567 Query: 570 R 570 R Sbjct: 568 R 568 Lambda K H 0.315 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 905 Number of extensions: 46 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 613 Length of database: 606 Length adjustment: 37 Effective length of query: 576 Effective length of database: 569 Effective search space: 327744 Effective search space used: 327744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory