Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate YP_001325872.1 Smed_0178 class I and II aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000017145.1:YP_001325872.1 Length = 396 Score = 142 bits (357), Expect = 2e-38 Identities = 107/366 (29%), Positives = 170/366 (46%), Gaps = 11/366 (3%) Query: 23 AAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQ 82 A + + + D++ L+ G+P + A++ + YS G P + A+ Y+ Sbjct: 24 ARQLKASGADIIELTIGEPDLPPDPALLEECQRAMNAGRYRYSNGRGEPAVVAALTEKYR 83 Query: 83 RRH-GITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVE 141 RR G+T E ++ G+ +AGD V + P Y Y ++ + G V Sbjct: 84 RRRSGVTKEN--ILCFPGTQTALFAVMFGLAEAGDGVLVGDPLYATYEGVIRSTGAHPVF 141 Query: 142 IPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLI 200 +P PQ F A+ L + + P R +++ +P NPTG V+ PEE+AAI + D+ ++ Sbjct: 142 VPLNPQHGFHMQAEDLEKAVTPECRVLLLNTPHNPTGAVLTPEEIAAIGAVARRHDLWIV 201 Query: 201 SDEVYHGLVYQGA-PQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCL 259 DEVY LV+ A + VVV+S SK +A TG+R GW + P + + Sbjct: 202 CDEVYEELVFDAAFASPFDNPDLAERTVVVSSISKSHAATGFRSGWAVGPAEFTERLLPI 261 Query: 260 TGNFTI-CPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDG 318 + P ++ + A + TA SY+ L +DGL + + P + Sbjct: 262 SETMLFGQQPFIADMTAYALTHEIGTARQ--MRESYSHRARLTIDGLAGVPGVSVLPPEA 319 Query: 319 AFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDF-DTARGGSFVRISFAGPSGDIEEA 377 + DVS + AF LL + GVA+ PG F DTAR +F+R+S P IEEA Sbjct: 320 GMFALIDVSGTSLSGEAFAWALLEEEGVAVMPGSSFGDTAR--NFLRVSLTVPDDVIEEA 377 Query: 378 LRRIGS 383 RRI + Sbjct: 378 CRRIAA 383 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 396 Length adjustment: 31 Effective length of query: 357 Effective length of database: 365 Effective search space: 130305 Effective search space used: 130305 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory