Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_012116106.1 XAUT_RS20925 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000017645.1:WP_012116106.1 Length = 370 Score = 431 bits (1108), Expect = e-125 Identities = 218/362 (60%), Positives = 267/362 (73%), Gaps = 15/362 (4%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+ NT G LFRVTTFGESHG A+GC+VDG PP + T D+Q LDRRRPG SR+TTQRR Sbjct: 1 MSFNTFGHLFRVTTFGESHGAAIGCVVDGCPPNLRFTLEDVQAALDRRRPGQSRFTTQRR 60 Query: 61 EPDQVKILSGVFEG-----VTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKY 115 EPDQVK+LSG E VTTGT I LLIEN DQRS+DY+ I +RPGHAD+TY+ KY Sbjct: 61 EPDQVKVLSGTLEHPEGGLVTTGTPIALLIENVDQRSKDYADIAGAYRPGHADFTYDIKY 120 Query: 116 GLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQV 173 G+RD+RGGGRSSARETA RVAAGAIA K L G+ +RG + ++G+I +D DW++V Sbjct: 121 GIRDHRGGGRSSARETATRVAAGAIAAKVLP---GVTVRGAVVRIGEIEIDRSRWDWNEV 177 Query: 174 EQNPFFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHA 233 NPFFCPDP + +E + A++K G SIGA V +VA GVPAGLG P++ +LDAD+A A Sbjct: 178 PNNPFFCPDPKTVPLWEEYLDAVRKAGSSIGAVVELVAEGVPAGLGAPLYGKLDADLASA 237 Query: 234 LMSINAVKGVEIGDGFDVVALRGSQNRDEIT-----KDGFQSNHAGGILGGISSGQQIIA 288 L+ INA KGVEIG+GF+ L G +N DE+ + F SNHAGGILGGI++G I+A Sbjct: 238 LLGINAAKGVEIGEGFNAAQLTGEENADEMRLGNEGRPQFLSNHAGGILGGIATGAPIVA 297 Query: 289 HMALKPTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQR 348 ALKPTSSI P +T++R G+E E+ TKGRHDPCVGIRAVP+ EAM+ VL DH LR R Sbjct: 298 RFALKPTSSILTPRQTVDRTGQETEIFTKGRHDPCVGIRAVPVGEAMMWCVLADHFLRHR 357 Query: 349 AQ 350 Q Sbjct: 358 GQ 359 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 370 Length adjustment: 30 Effective length of query: 331 Effective length of database: 340 Effective search space: 112540 Effective search space used: 112540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012116106.1 XAUT_RS20925 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.32070.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-132 426.2 0.0 5.2e-132 426.0 0.0 1.0 1 lcl|NCBI__GCF_000017645.1:WP_012116106.1 XAUT_RS20925 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017645.1:WP_012116106.1 XAUT_RS20925 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.0 0.0 5.2e-132 5.2e-132 1 349 [. 10 358 .. 10 360 .. 0.97 Alignments for each domain: == domain 1 score: 426.0 bits; conditional E-value: 5.2e-132 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfe...G. 65 +r+ttfGeSHg+a+g+++dG+P++l+ t ed+q +l+rRrpgqsr+t++r+E D+v++lsG+ e G lcl|NCBI__GCF_000017645.1:WP_012116106.1 10 FRVTTFGESHGAAIGCVVDGCPPNLRFTLEDVQAALDRRRPGQSRFTTQRREPDQVKVLSGTLEhpeGg 78 89***********************************************************97534434 PP TIGR00033 66 .kTtGaPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavak 133 TtG+Pialli+N d+rskdy di+ +RPgHad+ty KYgi+d++gggrsSaReTa+rvaaGa+a lcl|NCBI__GCF_000017645.1:WP_012116106.1 79 lVTTGTPIALLIENVDQRSKDYADIAGAYRPGHADFTYDIKYGIRDHRGGGRSSARETATRVAAGAIAA 147 56******************************************************************* PP TIGR00033 134 klLketagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgv 202 k L + + + vv++ge+e++++ + +++ ++p++cpd+++ ee++d ++k+g s+G+v lcl|NCBI__GCF_000017645.1:WP_012116106.1 148 KVLPG---VTVRGAVVRIGEIEIDRSRWDW---NEVPNNPFFCPDPKTVPLWEEYLDAVRKAGSSIGAV 210 ***87...89**************988884...78999******************************* PP TIGR00033 203 vevvvsnvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrkt 270 ve+v+++vp+glG pl+ klda lasall+inA+KgveiG+GF+aa+ +G e De+ l +++ ++ + lcl|NCBI__GCF_000017645.1:WP_012116106.1 211 VELVAEGVPAGLGAPLYGKLDADLASALLGINAAKGVEIGEGFNAAQLTGEENADEMRLGnEGRPQFLS 279 **********************************************************9979999**** PP TIGR00033 271 nnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalv 339 n+ GGi+GGi++G +i+ r a+Kp+++i +p++tvd +++e+ tkgRhDpcv +ravpv Eam++ v lcl|NCBI__GCF_000017645.1:WP_012116106.1 280 NHAGGILGGIATGAPIVARFALKPTSSILTPRQTVDRTGQETEIFTKGRHDPCVGIRAVPVGEAMMWCV 348 ********************************************************************* PP TIGR00033 340 ladallekra 349 lad++l++r+ lcl|NCBI__GCF_000017645.1:WP_012116106.1 349 LADHFLRHRG 358 *******987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory