Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_012112532.1 XAUT_RS02535 2-hydroxyacid dehydrogenase
Query= BRENDA::O58256 (333 letters) >NCBI__GCF_000017645.1:WP_012112532.1 Length = 322 Score = 135 bits (340), Expect = 1e-36 Identities = 85/262 (32%), Positives = 139/262 (53%), Gaps = 10/262 (3%) Query: 53 KITREVLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINL 112 ++ ++ LK+++ GYD +D A +RG+ VT +L+E VA+ T+GL++ Sbjct: 58 RVDEALMARLPALKIVANFGVGYDTVDAAAAARRGVIVTNTPDVLNEEVADLTLGLLLAT 117 Query: 113 MRKIHYADKFIRRGEWESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRLIPFGVKL 172 +R+I AD+F+R G+W A + +L + VGI+GMG IGKAIARRL F V + Sbjct: 118 VRQIPQADRFVRDGKWLKGA-----YPLGPTLRERTVGIVGMGRIGKAIARRLEAFAVPV 172 Query: 173 YYWSRHRKVNVEKELKARYMDIDELLEKSDIVILALPLTRDTYHIINEERVKKL-EGKYL 231 Y SR ++ +V+ A +D L ++++ +P T H++N + + L L Sbjct: 173 AYHSRRQQPDVDLPYFASLLD---LARAVSVLVVIVPGGAATRHLVNADVLAALGPDGIL 229 Query: 232 VNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVREHELFKYEWETVLTPHYAGLALE 291 +N+ RG +VDE A+ +A++ + DVFEKEP E F VL PH Sbjct: 230 INVARGTVVDEAALLKALQSRTILAAGLDVFEKEP-HVPEAFLGLDNVVLLPHVGSSTHH 288 Query: 292 AQEDVGFRAVENLLKVLRGEVP 313 + +G V+N++ L G+ P Sbjct: 289 TRAAMGQLVVDNIVAFLDGKGP 310 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 322 Length adjustment: 28 Effective length of query: 305 Effective length of database: 294 Effective search space: 89670 Effective search space used: 89670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory