Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate WP_009543491.1 CCE_RS20960 3-dehydroquinate synthase
Query= curated2:B6J4A4 (360 letters) >NCBI__GCF_000017845.1:WP_009543491.1 Length = 412 Score = 152 bits (383), Expect = 2e-41 Identities = 97/294 (32%), Positives = 151/294 (51%), Gaps = 16/294 (5%) Query: 67 FILPDGEQYKT----LEYWERILHKLASCNHHRDTTLIALGGGVVGDITGFAAACYQRGV 122 F++P GE K ++Y ++ L++ C H + ++ +GGG V D+ G+ AA RG+ Sbjct: 103 FVIPGGETAKNEPALIKYLQKQLNRTGLCRH---SYVVGIGGGAVLDLVGYIAATTHRGI 159 Query: 123 DFIQVPTTLLAQVDASIGGKTAVNHPVGKNLIGAFHQPKAVIIDLNTLNTLPEREFKAGM 182 I+VPTT+LAQ D+ +G K VN KN +G F P AV+ D L TL +R+++ G+ Sbjct: 160 RLIRVPTTVLAQNDSGVGVKNGVNTFGKKNFLGTFAPPYAVLNDFTFLTTLDDRDWRGGV 219 Query: 183 AEIVKAALIKDEKFFTDLENKMSDLLQRNFIFLQAVIKRAAEI-KRDIVNADEKERSGER 241 AE VK ALIKD FF +E + + R+ +Q VI R A++ I + G Sbjct: 220 AEAVKVALIKDRSFFEAIEAQAKAIANRHMAPMQQVIYRCAQLHMAHIAGQGDPFEMGSS 279 Query: 242 ALLNLGHTFAHAIERLLGYGQWLHGEAVSAGLVLAAQLSHRKNLLDFESLQRICRLLTQI 301 L+ GH AH +E L Y HGEAV+ G+ L S+ LL +RIC L + Sbjct: 280 RPLDFGHWVAHRLESLTHY-NLRHGEAVAIGIALDCTYSYLSQLLSKTDWERICHTLKTL 338 Query: 302 SLPIHFPK-------SINADELLSAMYMDKKVANERLHLILLEDLGHAVVSDQV 348 ++ P+ + D L + + ++ L L+LL+++G + QV Sbjct: 339 GFALYVPELSTHLDHPDHPDSLFAGLKEFQEHLGGELTLMLLQEIGTGLEVHQV 392 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 412 Length adjustment: 30 Effective length of query: 330 Effective length of database: 382 Effective search space: 126060 Effective search space used: 126060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory